KEGG   Chlamydia psittaci 08DC60: CPS0D_1083Help
Entry
CPS0D_1083        CDS       T01862                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cht  Chlamydia psittaci 08DC60
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cht03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1164003..1165517)
Genome map
AA seq 504 aa AA seqDB search
MLSLSPDVSHLLYDVVQQQIVLPLDLAFAKRHISPESKKAFAFLAISSALWRCGYPFLSI
ENERLFPSVSGISEKLFYEYFQALPHDVLSSLFVIENNKIYLKSLYTVREKLFKKLSLLS
QASNRYSLTTTTLSSLSQEQNEVFHKAVNSCFSLICGGPGTGKTFLAVQIIIALIKQYPK
IRIAIVSPTGKATSHIRHILSKHHISESSVTIQTIHRFLQEHAYHQCASFDLLLVDEGSM
VTFSLLHSLVNTLSGENKHGKIIADNLIILGDENQLPPIGVGAGNPLQDLIARFPERALH
LHVSHRAKTNRVQNFARAVLERQAIPFTPLPPLLTALSMIKEAFINTPSSQTQLCVLTPM
RHGPWGYLRLNELLFHEIQKTHPELPIPIMITERYEAWGLFNGDTGYLCPKTQKLFFSHS
RFIDAKEFSYYTYNYAMSVHKSQGSEYEDVIVIIPKGCETFDISILYTAITRAKNNIDVW
ADRETLYKIIKKPHKYTYGVDRLL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgttaagcccggatgtttctcaccttctttatgatgtagttcaacaacagatt
gttctacctttggacctagcttttgcgaagcgccatatctctccagaatcaaaaaaagcg
tttgcatttctggctatttcttctgctctttggcgttgtggttatccctttcttagtata
gaaaatgagcgtttattcccttcagtatccggaatttctgaaaagctgttttatgaatat
tttcaggctcttcctcacgatgttttgtcgtcgttgtttgtgatagaaaataataaaatt
tatttaaaatctttatatacagttcgtgagaaactttttaaaaaactctctttgttgtca
caagcttctaatcggtacagcctgactacaacaactctgtcgagtttatctcaggagcaa
aatgaggtttttcacaaagctgttaacagttgtttttctttgatctgtggtgggccggga
acagggaagacatttcttgctgtacagataatcatcgcgttaattaagcagtatcctaaa
atccgtattgctatagtctctcctacaggaaaagcaacctctcatatccgtcacatactc
tctaaacatcatatttctgagtctagtgtcacaatccaaacaatacaccgattcttgcaa
gaacatgcgtatcaccagtgcgcttcttttgatttattattagttgatgaggggtctatg
gtgacatttagtcttctgcatagcctagtcaacactttatcaggggaaaataaacacggg
aaaatcattgctgataatttaattatattgggagatgagaatcagctcccccccataggt
gttggcgccggaaatcctcttcaagatttgatagcacgtttccctgaaagagctctacat
cttcatgtttctcacagagctaaaacaaatagagttcaaaattttgctagagctgtttta
gaaagacaagccattccttttacccctttgcctcctttgctcactgcactttctatgatt
aaagaggcgtttataaataccccctcatctcaaacacaattgtgtgttttaactcctatg
cgacatggtccttggggatacctacgcttaaatgaactgctctttcatgaaatacaaaaa
acacatccagagttacccattcctattatgataacagaacgttatgaagcttgggggcta
tttaatggtgatacggggtacctttgcccaaagacgcaaaagttatttttttctcactct
cgctttatcgatgccaaagagttttcttattatacctataactacgctatgtcagtgcat
aaaagtcagggaagtgagtacgaggacgtcattgttattatccctaaagggtgtgaaact
tttgacatttctattctttacacagcgatcacacgtgcaaagaacaacatagatgtgtgg
gctgatcgagagacgttgtataagatcataaaaaaaccccataagtatacttatggggta
gatcgtcttctttag

DBGET integrated database retrieval system