KEGG   Cytophaga hutchinsonii: CHU_0075Help
Entry
CHU_0075          CDS       T00385                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHU_0075 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHU_0075 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CHU_0075 (thrC)
Enzymes [BR:chu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CHU_0075 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
89257..90561
Genome map
AA seq 434 aa AA seqDB search
MKLYSTNHQVPEVNLKEAVFKGLPDDNGLYMPENIPTLPASFFENIDTLSFQDIAFEVCK
ALIGDEVPEKEIRSIVDDVLTFDAPVVKVENNIYVLELFHGPTLAFKDFGARFMARLMSY
FLQKEKKDIMILVATSGDTGSAVAQGFLDKAGIKVTILYPSKKVSDLQEKQLTTLGKNIT
ALEVLGTFDDCQRMVKQAFLDKEITSKINLSSANSINISRLIPQSFYYFYAYAQAKKLGK
KVVFSVPSGNFGNICAGLIAKKMGLPIDMFVASTNANDIMPKYINTGVFEAKPSVATISN
AMDVGNPSNYPRVIELYGKDINALRKDVVGKAYTDEETAAAVKSVYKATGYVMDPHGAVG
YLGLKEYFEESGKDATGIFLATAHPAKFIEVVNDIIEKDVEIPAQLKELINKKQESIVIE
NDFEKLKSFLLTAL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacagtacaaatcatcaggtaccagaagtaaatttaaaagaagcagtattc
aaaggtttaccggatgataacggtttatatatgccggagaatattccaacattgccggct
tcattttttgaaaacattgataccctttcttttcaggatattgcctttgaagtatgcaaa
gcattgatcggtgatgaagttccggaaaaagaaatcagaagcattgttgatgatgtatta
acgtttgacgcacctgttgttaaggttgaaaacaacatctatgtgcttgaattgtttcat
ggccctacgctggcattcaaagatttcggtgcccgtttcatggcccgtctgatgtcttac
tttttacaaaaagaaaagaaagacatcatgattttagtagcaacatccggagatactggc
agcgccgttgcacagggttttctggacaaagcaggtattaaagttaccatcttatatcca
agcaaaaaggtaagtgatctgcaggaaaagcagcttacaacacttggtaaaaacattacg
gcacttgaagtgctgggtacgtttgacgattgtcagcgtatggtaaaacaagcgttcttg
gataaagaaattacatctaagatcaacctgtcttctgcaaattcaatcaacatcagtcgt
ttgattccacagtcgttttattatttctatgcctacgcacaagcgaaaaagctaggaaag
aaagttgttttctctgtgccaagcggaaacttcggaaatatatgcgcaggtttgattgcc
aagaaaatgggcttgccgattgatatgtttgtagcttctacaaatgcaaacgacattatg
cctaaatacattaatacaggagtatttgaagcaaaaccttctgttgcaacaatcagcaat
gccatggatgttggaaatccaagcaactacccgcgtgtgattgaattatacgggaaagat
atcaatgcattgcgtaaagatgtagttggtaaagcatatacagatgaagagacagcagct
gcggttaagtctgtatataaggctacaggatacgtgatggatccgcatggtgccgttggt
tacttaggcttaaaagaatactttgaagaaagcggaaaagatgctacaggtatattctta
gctacagcacatccggctaagtttattgaagtcgtaaatgatatcattgaaaaagatgta
gagattcctgcgcaactgaaagaactgatcaataagaaacaggaatctattgttattgaa
aatgattttgaaaaactgaaatcgtttctgttgacggctctttaa

DBGET integrated database retrieval system