KEGG   Cytophaga hutchinsonii: CHU_0075Help
Entry
CHU_0075          CDS       T00385                                 

Gene name
thrC
Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00260  Glycine, serine and threonine metabolism
chu00750  Vitamin B6 metabolism
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01120  Microbial metabolism in diverse environments
chu01230  Biosynthesis of amino acids
Module
chu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHU_0075 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CHU_0075 (thrC)
Enzymes [BR:chu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CHU_0075 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABG57369
UniProt: Q11YZ7
Position
89257..90561
Genome map
AA seq 434 aa AA seqDB search
MKLYSTNHQVPEVNLKEAVFKGLPDDNGLYMPENIPTLPASFFENIDTLSFQDIAFEVCK
ALIGDEVPEKEIRSIVDDVLTFDAPVVKVENNIYVLELFHGPTLAFKDFGARFMARLMSY
FLQKEKKDIMILVATSGDTGSAVAQGFLDKAGIKVTILYPSKKVSDLQEKQLTTLGKNIT
ALEVLGTFDDCQRMVKQAFLDKEITSKINLSSANSINISRLIPQSFYYFYAYAQAKKLGK
KVVFSVPSGNFGNICAGLIAKKMGLPIDMFVASTNANDIMPKYINTGVFEAKPSVATISN
AMDVGNPSNYPRVIELYGKDINALRKDVVGKAYTDEETAAAVKSVYKATGYVMDPHGAVG
YLGLKEYFEESGKDATGIFLATAHPAKFIEVVNDIIEKDVEIPAQLKELINKKQESIVIE
NDFEKLKSFLLTAL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacagtacaaatcatcaggtaccagaagtaaatttaaaagaagcagtattc
aaaggtttaccggatgataacggtttatatatgccggagaatattccaacattgccggct
tcattttttgaaaacattgataccctttcttttcaggatattgcctttgaagtatgcaaa
gcattgatcggtgatgaagttccggaaaaagaaatcagaagcattgttgatgatgtatta
acgtttgacgcacctgttgttaaggttgaaaacaacatctatgtgcttgaattgtttcat
ggccctacgctggcattcaaagatttcggtgcccgtttcatggcccgtctgatgtcttac
tttttacaaaaagaaaagaaagacatcatgattttagtagcaacatccggagatactggc
agcgccgttgcacagggttttctggacaaagcaggtattaaagttaccatcttatatcca
agcaaaaaggtaagtgatctgcaggaaaagcagcttacaacacttggtaaaaacattacg
gcacttgaagtgctgggtacgtttgacgattgtcagcgtatggtaaaacaagcgttcttg
gataaagaaattacatctaagatcaacctgtcttctgcaaattcaatcaacatcagtcgt
ttgattccacagtcgttttattatttctatgcctacgcacaagcgaaaaagctaggaaag
aaagttgttttctctgtgccaagcggaaacttcggaaatatatgcgcaggtttgattgcc
aagaaaatgggcttgccgattgatatgtttgtagcttctacaaatgcaaacgacattatg
cctaaatacattaatacaggagtatttgaagcaaaaccttctgttgcaacaatcagcaat
gccatggatgttggaaatccaagcaactacccgcgtgtgattgaattatacgggaaagat
atcaatgcattgcgtaaagatgtagttggtaaagcatatacagatgaagagacagcagct
gcggttaagtctgtatataaggctacaggatacgtgatggatccgcatggtgccgttggt
tacttaggcttaaaagaatactttgaagaaagcggaaaagatgctacaggtatattctta
gctacagcacatccggctaagtttattgaagtcgtaaatgatatcattgaaaaagatgta
gagattcctgcgcaactgaaagaactgatcaataagaaacaggaatctattgttattgaa
aatgattttgaaaaactgaaatcgtttctgttgacggctctttaa

DBGET integrated database retrieval system