KEGG   Cytophaga hutchinsonii: CHU_0169Help
Entry
CHU_0169          CDS       T00385                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
chu  Cytophaga hutchinsonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
209919..210716
Genome map
AA seq 265 aa AA seqDB search
MSEIKAKDKHAKDNRVKKVGTILVSQPKPTDEKSPYYVLAEKYNLKIDFIPFIQIEQVDL
KEFKKQKIEILAHTAVIFTSRNAIDNFFRICTEAKIEVPAEMKYFCITEQTANYLQKYIV
IRKRKIFVGKKTASDLEEVIKKHKTEKFLYPCSDIRKDDIPMFLSQNGFTFSEAVFYKTV
ASDLSHLADVNYDIITFFSPSGISSLFVNFPDFEQKATRIAAFGPTTAKAVHDAGLILDV
EAPLPNAPSMTGALEIYIKKANNIK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaggcaaaagacaaacacgctaaagataatagagttaaaaaagtagga
actattttggtttcacagccaaaaccaactgatgaaaaatcaccttattatgtattagct
gaaaagtataatctaaaaatagattttataccgtttatccaaattgagcaggtagattta
aaagaattcaaaaagcaaaaaattgaaatacttgcgcatacggcggttatttttaccagc
cgtaatgcaatagacaatttcttcaggatctgtaccgaagctaaaattgaagtgcctgct
gaaatgaaatatttttgtattacagaacagacagcgaattacctgcaaaaatatattgta
attagaaaaagaaagatatttgtaggtaaaaaaacagcttcagacctggaagaagtaatt
aaaaaacataaaactgaaaaattcttatatccttgttctgatataagaaaggacgatatt
ccaatgtttttgtctcaaaatggatttactttttcagaggcagtattttataaaacagtt
gcaagtgacttatctcatctagcggatgttaattatgatataataacattctttagtccg
tcaggaattagttcgttatttgtaaactttcctgattttgaacaaaaggcaaccagaatc
gcagcatttggtccaactacggcaaaagcagtgcatgacgcagggctgattttagatgtg
gaagcacctttaccaaatgcaccatctatgaccggagcattagagatatacattaaaaag
gccaataatattaaataa

DBGET integrated database retrieval system