KEGG   Cytophaga hutchinsonii: CHU_0399Help
Entry
CHU_0399          CDS       T00385                                 

Definition
glucoamylase-like protein (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
chu  Cytophaga hutchinsonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHU_0399
Enzymes [BR:chu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CHU_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
468142..469923
Genome map
AA seq 593 aa AA seqDB search
MKVPHKYDMGVVGNCSFIAYVNKNTNIDWMCLPRFDSDFMFGALLDKEKGGEFSIKPAEE
NTTTYEQRYLENTNILVTICHTASGSYKVTDFAPRFVQHNRNFRPLMLVRKIEVLTGKPR
VIVTCMPGNMRGRQQPETSYGSNHIRYLHLDADVRLSTNIPITYIIDQKEFSLTETKYMF
FTYGPPLEAAIDYTAEEFLQKTRQYWNNWVKTTYIVSFYQEQIIRSALALKLHQYEDTGG
IIAAGTTSLPESDGATRNWDYRYCWMRDTYYTLQAFNTIGHFEESEKYFHYIENIVANEL
DRIQPLYTLDCSKKIEEIELDLEGYKGNKPVRVGNDAYTHIQNDVYGQILASITPLFTDR
RLLHGNQFSTDIVYKLLAFIDKTMNEKDAGLWEFRHLKQLHCYTFLFHWVGAKSALKIGQ
LYGDHELIRKSTATIDKAAEMIERCYDPVRKVYTQAVGSTYLDASCIQLISMHYLDPSSE
KARLHLKAIEEDLMVKDGLLFRYKHEDDFGKPEVTFLVCAFWYVDALASVGRIDDAIKAF
ESLLTYTNHVGLLSEDVGLDGSQWGNFPQTYSHVGLMNSAYRIAKKLDRPSYI
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgccacataaatacgacatgggagtcgtagggaattgctcatttatcgcgtat
gtaaataaaaatacgaatattgactggatgtgtctgccaagatttgattcagattttatg
tttggcgcattgcttgataaagaaaagggcggagagttttcgattaagccggccgaagaa
aatacaacaacatatgaacaacgttatttagaaaatacaaacatactggtcaccatatgt
cataccgcttccggcagctacaaagtaaccgattttgcaccgcgatttgtgcagcataac
cggaacttcaggccgttaatgctggttcgtaaaattgaagtgctgacaggaaagccgcgc
gtaattgtaacatgtatgcctggaaacatgcggggcaggcagcagccggaaacttcatac
ggaagcaatcacatccgctatctgcacctcgatgcagatgttcggttgagtacgaatatt
ccgatcacatacattattgatcaaaaggaattttcgctaacagaaaccaagtatatgttt
tttacttatggtccgcctcttgaagctgccattgattatacggctgaagagtttcttcag
aagacgcgccaatactggaacaattgggtaaagacaacttatattgtaagtttttatcag
gaacagattatccgttctgcgctggcacttaagctgcatcagtatgaagatacaggcggt
attattgctgccggaacaacgagcctgccggaaagtgacggagcaacacgaaattgggat
tacagatattgctggatgcgggatacgtattataccttacaggcattcaataccatcgga
cactttgaagagtcagaaaaatattttcactacatagaaaatattgtagcgaatgaattg
gatcgtatccaacccttgtacacccttgattgttcgaaaaaaatagaagaaatagaatta
gacctggaaggatataaaggaaataagcctgtgcgcgttggtaacgatgcatatacacat
attcagaatgatgtatacggacagatactggcaagtattacacccctgtttacagacagg
cgcttgctgcacggtaatcagttctcaacggatatcgtttataagcttcttgcttttatt
gataaaacaatgaatgaaaaagatgcaggcctctgggagttcaggcatttgaagcaactg
cattgctatacctttttattccattgggtaggagcgaagtctgccttaaagatcggacag
ctgtatggcgatcatgaattgattagaaaatctactgcaacaattgacaaagccgctgaa
atgattgagcgctgttatgatcccgttcgcaaggtgtatacacaagcagttggttcaacc
tatctggatgcaagctgtattcagctgatcagtatgcattacttagatccttcgtctgaa
aaagcgcgcctgcatttaaaagcaatcgaagaggatctgatggttaaagatggcttgtta
ttccggtataaacacgaagatgattttggaaaaccggaagtaacctttttagtgtgtgca
ttctggtatgtagatgcactggcgtctgtgggtcgcattgatgacgcgataaaggcattt
gaatcgttacttacatatacaaaccatgttggtttgttgagtgaagatgtagggctggat
ggcagccaatggggcaattttccgcaaacatacagtcatgtaggtcttatgaactctgct
taccggattgcaaaaaaattagatcgtccatcatatatataa

DBGET integrated database retrieval system