KEGG   Cytophaga hutchinsonii: CHU_0402Help
Entry
CHU_0402          CDS       T00385                                 

Gene name
folA
Definition
dihydrofolate reductase (DHFR) (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
chu  Cytophaga hutchinsonii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:chu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(472547..473104)
Genome map
AA seq 185 aa AA seqDB search
MKKLRMFNFITLNGFYKDIANDIGWHTHGGEERDFSNEMLKQNNILLFGRVTYQMMAAFW
PTDMAINSMPEVAHRMNAAEKIVFSNTLKKADWNNTTIIEEDIIEKVKRIKQTAHKDLTI
LGSGSIINQFTEAGLIDTYQLLLDPIAIGKGTPLFHDIKQQFNLNLVDTRVFKSGSVLLT
YESTN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctacgcatgtttaattttataaccttaaatggtttttacaaagatatagca
aatgatatcggctggcacacacatggcggagaagaacgtgatttttcaaacgaaatgtta
aaacaaaataacattcttctgtttggacgtgttacgtatcaaatgatggctgccttctgg
cctacggatatggctataaattcaatgccagaggttgctcacagaatgaatgctgctgaa
aagattgtattttcaaacacattaaaaaaggcagactggaacaatacaacaattattgaa
gaagatatcattgaaaaggttaagcgcataaaacaaacagcgcataaagacctgaccatc
ttaggtagcggcagcattatcaatcaatttaccgaagcaggtttgattgatacgtatcaa
ctgctgctagatcctatcgctattggaaaaggaacacctttattccatgatataaaacag
cagttcaatcttaatcttgttgatacaagggtatttaaaagcggcagtgtattacttacg
tatgaatcaacaaactga

DBGET integrated database retrieval system