KEGG   Cytophaga hutchinsonii: CHU_0523Help
Entry
CHU_0523          CDS       T00385                                 

Gene name
ccpA
Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
chu  Cytophaga hutchinsonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
601512..602543
Genome map
AA seq 343 aa AA seqDB search
MIKQNTTCTIYTRGCFIFLWCILLLSCRRGNDPADEIAEGNKIISLQVPKGLLYPDVPAD
NQPTKNRIELGRMLFFDPILSRDSSVSCSTCHQTDKFFADNLKVSVGIEGRKGTRNAPSL
INVAYQPSMFWDGGNPTLEQQVIAPIDNHDEFDFDVNSIVAKLKVHPLYANLFQQAYDQE
PGVYSLTRAIACFERTLLAADSRYDDYLQNGNGNALSASEIRGMNLFFSEEGECFHCHQG
ALFTDYSFRNNGLYMQYADSGRARITQDLSDIGKFKVPSLRNAEMTAPYMHDGSIQTLEE
VVEHYSRGGVRHPNKSPIIQPLNLNAQQKEDLVNFIKSLTDKR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcaaaatacaacgtgtactatatataccagaggatgttttattttcctctgg
tgtatacttctgttatcgtgccgaagaggaaatgacccggcagatgagatcgctgagggt
aataaaatcatctcactgcaggtgccgaagggattgttgtatcccgatgttcccgcagat
aaccagccgacaaaaaacagaatagaattgggaaggatgctgttctttgatcccatactt
tcaagagacagttcggtgtcgtgctctacgtgtcaccagacggataagttctttgcggat
aatttaaaagtgagtgtcgggatcgaaggacgaaaaggcacacggaatgcgccatcactg
attaatgttgcctaccagccgtctatgttctgggatggaggtaatcctacgttagagcag
caggtgatcgctccgattgataatcacgatgagtttgactttgatgtaaattccattgtt
gcaaagctgaaggtacatcccctgtatgcaaacctgtttcagcaggcgtatgatcaggag
ccaggcgtgtatagccttacgcgtgcaattgcctgttttgagcggacgttgcttgcggcg
gattcccgctacgatgattatctgcagaacggaaacgggaatgcgctgagtgcatcagag
atcagagggatgaatttattcttcagcgaagagggcgaatgttttcattgtcaccaggga
gcgctgtttaccgattacagtttcaggaataacgggctgtatatgcaatatgccgattcg
ggaagagcgcgtattacacaggatctttctgatatcggaaagtttaaagtgccttcgttg
cggaatgcggagatgactgctccatatatgcacgacggaagtattcaaacacttgaggaa
gttgttgaacattacagcaggggcggtgtccggcatccgaataaaagccccattatccag
ccattgaatctgaatgcgcagcaaaaagaggatctggtcaattttattaaatcattaaca
gataaacgataa

DBGET integrated database retrieval system