KEGG   Cytophaga hutchinsonii: CHU_0638Help
Entry
CHU_0638          CDS       T00385                                 

Gene name
cysQ
Definition
sulfite synthesis pathway protein (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
chu  Cytophaga hutchinsonii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CHU_0638 (cysQ)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CHU_0638 (cysQ)
Transfer RNA biogenesis [BR:chu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CHU_0638 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
740462..741247
Genome map
AA seq 261 aa AA seqDB search
MKFKTDLMNNLLENAIVASMVAGKAIMEVYAIPDFTDLIEIKNDKSPLTVADKNAHQVIY
TLLRGEFPEIPMISEEGKGTPYEERKDWKRYWLVDPLDGTKEFIKRNGEFTVNIALIENN
RPVMGVVYIPVTDTLYAGIVGQGAFKIVNGEETPITVRKAPDTGRTAVGSRSHSTEEEAK
LLADYNVTDFITTGSSIKFCLVAEGTADLYYRAGPTMEWDTAAGQAVLEAAGGTLTNPDG
SMFLYNKENLLNGGFLCKGDI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttaaaaccgatttgatgaataatttacttgaaaatgcaattgtagcgagtatg
gtggcgggaaaagcaatcatggaggtctatgcaatacccgattttacggatctgatcgaa
atcaaaaacgataaatccccccttacggtcgcagataaaaatgcacatcaagtgatttat
acccttttgagaggtgaattccctgagattccgatgatctcggaagaaggaaaaggtact
ccgtacgaagaacgtaaagactggaaacggtactggctggttgatccgctggatggaaca
aaggaattcatcaaacgcaacggagagtttaccgtaaacattgccttgatcgaaaataac
cgtccggtgatgggcgtggtatacattcccgtaacagacaccttgtatgccgggatcgtg
gggcaaggtgccttcaaaattgtgaacggcgaagaaacgccgattaccgtacgcaaggca
ccggatacaggccggacagccgtgggatcgcgttcacacagtacggaagaagaagcaaaa
ttattggccgattataacgtaaccgattttatcacaacgggaagctcgatcaaattctgt
ttggtagcggaaggtacagcggacctgtattaccgcgccggacctacaatggagtgggac
actgccgccgggcaagctgtattagaagccgcaggcggaacattgacaaatcccgatgga
tcgatgtttttatacaacaaagaaaatttattgaacggcggatttttgtgcaagggagat
atttaa

DBGET integrated database retrieval system