KEGG   Cytophaga hutchinsonii: CHU_0646Help
Entry
CHU_0646          CDS       T00385                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
chu  Cytophaga hutchinsonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHU_0646 (hemB)
Enzymes [BR:chu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CHU_0646 (hemB)
Exosome [BR:chu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHU_0646 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(745295..746263)
Genome map
AA seq 322 aa AA seqDB search
MRRPRRNRKSEAVRQLVKEHRVYTEDLMFPLFLTGGTNVKTEIASMPGIFRFSEDNLLRE
IDSCMNLGLRSFVLFPHFPDEVKDPYATISYQENMYLKALREIKKRFPECCLMTDVALDP
YSSDGHDGIVVNGEIVNDETLIVLGKMAVAQAQAGADIVGPSDMMDGRVGFIRDMLDDSG
FTNTSIMAYTAKYASAFYGPFRDALDSAPKSGDKKTYQMDPANVTEALLEAELDVQEGAD
IIMVKPALAYLDVIKTLYDQFDVPIAAYNVSGEYAMVKAAAANGWIDNDKVMLETLLSMK
RAGAKIILTYFAKEFAGKVKYF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtccgagaagaaaccgtaagtcagaagctgtccgtcagttagtaaaagaacac
cgggtatataccgaagatctgatgttcccgctttttttaaccggtggaacaaatgttaaa
accgagattgcttcgatgccgggcatctttcgtttttcagaagataatctgcttcgtgaa
atcgacagctgcatgaatctggggttgcgttcgtttgtattgtttccgcattttccggat
gaagtaaaagatccatatgcaaccatcagctaccaggagaatatgtatctgaaagcactt
cgtgaaattaaaaagcgtttcccggaatgctgtctgatgaccgatgtggcacttgacccc
tactcttccgacgggcacgacggcattgttgtgaatggagaaattgtgaatgatgaaaca
ttgattgtattgggtaagatggcggtagcacaggcacaggccggtgccgacatcgtcgga
ccatcggacatgatggacggccgtgttggttttatccgcgacatgctggacgatagcggt
tttacgaatacctccatcatggcatacacggcaaaatacgcaagcgctttttacggtccg
ttccgggatgcgctggattcggctccgaagtcgggtgataaaaaaacgtatcagatggat
ccggccaatgttaccgaagccttactggaggcagaactggatgttcaggaaggtgcggac
atcattatggtaaaaccagcccttgcctatttagatgtaatcaaaaccttatatgaccaa
ttcgatgtaccaatcgcagcgtataacgtgagcggtgagtatgccatggtaaaagctgct
gctgccaacggctggatcgataacgataaggtgatgcttgaaaccttattaagcatgaaa
cgtgcgggtgcaaaaattatccttacctattttgcgaaggagtttgcgggtaaggtgaag
tatttttaa

DBGET integrated database retrieval system