KEGG   Cytophaga hutchinsonii: CHU_0955Help
Entry
CHU_0955          CDS       T00385                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00790  Folate biosynthesis
chu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHU_0955 (folE)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CHU_0955 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF FAD-SLDH
Motif
Other DBs
NCBI-ProteinID: ABG58232
UniProt: Q11WI4
Position
complement(1101870..1102559)
Genome map
AA seq 229 aa AA seqDB search
MKQNETLLNTRHKSDSMDELGEDHVSTSAETPLREDAFEKDDALKIELIQKHFKEIMLIL
GLDLTDDSLKGTPNRVAKMYVQEIFSGLNPANKPSIRLFENKYKYSEMLVEKDITLYSYC
EHHFVPIIGKAHVAYISNGKVIGLSKINRLVEHFSKRPQVQERLTVQIAEALKEALQTED
VAIVIDAAHLCVSSRGVKDTASTTITAHYSGKFTEDQTKNEFLAFIQKK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaacgaaactttgttgaatacccggcataaatcagacagcatggatgaatta
ggtgaagaccacgtttcaacatcagcagaaacacctcttagagaagatgcttttgaaaaa
gacgatgcgttaaagattgaattgatacaaaaacattttaaagaaatcatgctcattctg
ggcctggatcttacagatgacagcctgaagggtacacccaaccgtgttgcaaaaatgtat
gtgcaggaaatattcagcggattaaatcctgcgaataaacccagcatacgtttatttgaa
aataaatataaatacagtgaaatgctggtggagaaagatattacgctctactcctattgc
gaacatcactttgtgcctatcattggaaaggcacatgtagcatacatttccaatggaaaa
gttattggtttatcaaaaataaaccggctggttgaacatttttctaaaagaccacaggta
caggaacgtttaaccgtacagatcgctgaagcattaaaagaagcgttgcaaacagaagat
gtagccattgttattgatgcggcacatttatgtgtatcttcccgtggtgtaaaggatacc
gcaagtactacgattactgctcactattctggtaagtttaccgaagatcaaacgaaaaat
gaatttctggcattcattcagaaaaaataa

DBGET integrated database retrieval system