KEGG   Cytophaga hutchinsonii: CHU_1045Help
Entry
CHU_1045          CDS       T00385                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
chu  Cytophaga hutchinsonii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:chu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1206846..1207463)
Genome map
AA seq 205 aa AA seqDB search
MNFPSKLLEDAVLEISKLPGIGKKTALRLVLHLLKKESKESESLANALLNARENIRYCKK
CHTISDHELCAICTSNKRDKRVVCIVEDIRDVLAIENTNQYFGVYHVIGGVISPMERIGP
DQLNINSLIERVITDTEIKEIILGLSPTMEGDTTAFFITKKLKSYPIKISTIARGIPFGG
ELEYMDEVTLGRSIATRTLFETKED
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaactttccttctaaattattagaagatgctgtattggaaatctcaaagctcccgggt
attggaaaaaaaacagccttgagattagtacttcatttattaaagaaagaaagtaaagaa
tctgaaagtctggcgaatgcacttttaaatgcgcgcgaaaacatcaggtactgtaaaaag
tgtcataccatttcagatcatgaactgtgtgctatttgcaccagcaataaaagagataaa
cgtgtcgtttgtatcgtagaagatatacgcgatgtgttggcaattgaaaatacaaaccaa
tattttggtgtctatcacgtgatcggcggagtcatttcccccatggaacgtatagggccg
gatcagttaaatataaactcgttaatcgaacgtgttataaccgacaccgaaattaaagag
ataatacttggacttagtccaacgatggagggtgatacaactgcattctttattacaaag
aaactgaaatcctaccccattaaaatcagcacaattgccagaggaataccatttggaggc
gaactggaatatatggatgaagttacacttggaagaagtattgcaaccagaactttattt
gaaacaaaagaagattga

DBGET integrated database retrieval system