KEGG   Cytophaga hutchinsonii: CHU_1063Help
Entry
CHU_1063          CDS       T00385                                 

Definition
fatty-acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:chu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:chu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227774..1228832
Genome map
AA seq 352 aa AA seqDB search
MAFIDVVLQRPSYGWMDENGNLVKPAGKQLFAEFCSRINIFKSRKNWIALAGWFWVLCLL
PFLFLFLFTYFNWKLLFICIFYSMVVMGTHGTIWYHRYGTHRAFIFRNAFWRFITQNLVV
KLIPEEIYIVSHHVHHSKSDQPGDPYNASAGFLYCFLADTNHQPIAKDLDEKNYARAAVL
VKHTGIKINSYEQYQKWGSIADPGRTAALWIANWVCWYGIFYLIGGHALACALFSGALIW
VIGVRTFNYNGHGKGTESHRDGLDFNRKDLSVNQYRPGLLAGEWHNNHHMYPGSARSGFL
PYQIDFAWYYIYVLYKIGAVSSYHDSKKQFYENYYVPYKNASKKESVKDFVD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttattgatgtagtattgcagcgcccttcctacggatggatggatgaaaacgga
aatcttgtaaagcctgcgggcaagcaattgtttgcagagttctgttcaaggattaatatt
tttaaatcacgtaagaactggatagcattggcaggatggttttgggtactatgtttattg
ccttttctgtttttgtttttgtttacctattttaattggaagctgttgttcatttgtatc
ttctacagcatggtagtaatgggtacccacggcactatctggtaccatcggtacggtaca
caccgtgcttttatttttcgcaacgcattctggcgtttcattacccaaaacctggtagtt
aaattaattccggaagagatttacattgtatcgcatcatgtacatcattctaagtcggat
cagcccggagatccgtacaatgcttccgccgggtttttatattgttttttagccgataca
aaccatcagcccattgcaaaagatctggatgaaaaaaactatgcacgtgcagcggtactt
gtaaaacatacaggcataaaaatcaattcgtatgaacaatatcagaaatggggttcaatt
gccgatccgggccgcacggcagcgctctggatcgcaaactgggtttgctggtatggtata
ttttatctcattggagggcatgcacttgcctgtgcactttttagcggcgcactgatatgg
gtaataggcgttcgtacatttaactataatggccacggcaaaggtacggaaagtcatagg
gatggattggattttaatcgtaaagacttgtctgtaaaccaatatcgcccgggcttactt
gctggtgagtggcataacaatcatcatatgtatccgggaagtgcccgctcaggtttttta
ccgtatcagatagactttgcctggtactacatttatgtattgtataagataggggcagta
tcatcctaccatgattctaaaaaacagttttatgaaaactactatgtaccatataagaat
gccagtaaaaaagaatcagtaaaggatttcgttgactga

DBGET integrated database retrieval system