KEGG   Cytophaga hutchinsonii: CHU_1107Help
Entry
CHU_1107          CDS       T00385                                 

Definition
endoglucanase (EC:3.2.1.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
chu  Cytophaga hutchinsonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:chu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1283277..1287185
Genome map
AA seq 1302 aa AA seqDB search
MNIRSTLQAGLITLAMVFCSMLAVNAQTTPVQKYGQLKIFNGKVSDQNNNPVVLRGMSLF
WSGYPEGAPYYNATTVKWLRDDWCVDVVRAAMSVETGSSNYVNNPAAEMAKVKAVIDACI
ANGVYVIVDFHTHNAENYKNQAKTFFTEIATTYGNVPNVLYETFNEPIYQSWSGTIKPYH
NELIQTIRAKDPDNIIICGTRTYSQEVDEAANDPVTGTNIAYTVHYYANSHQGSLRQKVT
NALNKGVAIFATEYGTTDASGNGGYNPGESQTWWNFLEANKISSANWSVTNKNETSAALK
PGTGISNWTTNDLTASGALVRAYLKGKCNVTVTTGSVTVAFAGNKIVYDAGETVTMTATA
TVANGTISKVEFYSGTTLLNSDASSPYTFSTSTLASGGHSITAKSYDAAGAVIAISPVYV
ISIIGASNVATTGITDQFENTDQFSELTGGVNGASCGTATAAAAAGIYWFEDRDAATPFK
AEATRTGNGTLQYLISQPQKSYNVIGFNFGEYCQGTTKQKYTLDLTQNAVLQLTVAAPAT
NTATLDLKFQMKDADGTVIAINKTFLTETVATNWYKYEIGFSKNHLAPDYLSLAPGTTTN
FSFDFKNTLSIKNPNNPNFPTDINLNNTDFDFSKVVEVVIIPVNKQDTGTPNYDPLAFTD
QKIIFSGLKLGNPALGVDICTTPKAVTTATKSYCQNATNAVALTATGTAGLTLKWYASAT
GGVANTVAPIPSTSVAGDQTYYVSQAVPGSSTCEGPRTELKVTIVPAATSDAGQDVTITS
ATSASLTAVGSSAGTWSTYSVPTGATVTFSPSATSAAVTANGLTVNGTYGFVYTVAGTGS
CASAKDSVAVTKTVPPCTTPNAVTPADISYCRGSLNAVPLTASGLATGNKFQWYTNATGG
AASDNAPTPSTTTAGITTYYVSQVSTTNASCESVRSPLKVTIVAPATASAGNTIAISTET
SVTLTGTGSAVGTWSLLIKPTGAGTVTFSPTTGASVTASGLTVDGTYTFTYTVQGTSPCG
AVAASVNVNKTSPSCTNPATANAGNNQTISTATSATLTGSGSSAGTWSVQNKPGAANVTF
SGTGASVTANGLTADGVYTFVYTVSATSPCVAATSTMTVTKTTPVCTNPTVANAGMDQTI
STANTVTLTGTGTTAGTWTVFSKPAGTTVTITPSGTAATVTASGLTATGVYEFTYTVNGV
SPCITASDVMKVTKSTTTAINSAYLNDNIELYPNPVTETLFIGMDRVEGSKSLTVVDMLG
KIVYAADAVSIANIDMSDLSRGMYFVHIETESGKITKSVIKQ
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacgttcgactctgcaagccgggttaataaccctggcaatggtcttttgcagc
atgcttgctgtaaatgcacaaacgacacccgttcagaaatacgggcagttaaaaattttc
aacggaaaagtttccgatcagaacaacaacccggttgttttacgcgggatgtccttattc
tggagcgggtatccggaaggagcaccgtactacaatgcaactactgttaaatggctgcgg
gatgactggtgtgtggatgtagtccgtgctgccatgtctgttgaaacaggatcttccaac
tacgtaaataatccggcggcagaaatggctaaggtgaaagccgttatagatgcctgtatt
gccaatggcgtatacgtaattgtcgattttcatacccataatgccgaaaactataaaaac
caggcaaaaacgttttttacggagatcgcaacaacgtatggcaatgtgccaaacgtttta
tacgaaacgttcaacgaacctatttatcaatcttggtcaggtacgattaagccttaccac
aatgagttgatacagaccatccgtgcaaaagatccggataacatcattatctgcggtaca
agaacatattctcaggaagtggatgaagcggcaaacgatccggttacaggaacgaacatt
gcgtacactgtacactactatgcaaattcacaccagggttcattaagacaaaaagttaca
aatgccttaaacaaaggtgttgcaattttcgctaccgaatacggtacaaccgatgcttcc
ggtaacggcggctataacccgggcgaatcgcagacctggtggaatttccttgaagcaaat
aaaataagttcagccaactggtctgttacaaataaaaatgaaacttctgcggcattaaag
ccgggtacaggcatcagcaactggacaaccaacgatcttacagcttcaggtgcgcttgta
cgggcatatctgaagggtaaatgtaatgttacggttactacaggatctgttaccgttgca
tttgcaggaaataagattgtatatgatgcgggcgaaacagttactatgacagctactgct
acagtagcaaacggtacaatctcaaaagtggaattctatagcggtacaacgttattgaat
tcagacgcttcgagcccgtatacattttcaacatcaacgcttgcatcgggtggtcacagc
atcactgcaaaatcatatgatgcagcaggcgctgtaattgcaatatctccggtatatgta
ataagtattattggtgcgtcaaatgttgctacaacaggtatcaccgatcagtttgaaaac
acagatcagttctctgagttaacaggcggtgtaaatggtgcaagctgcggtacagctaca
gcggcagcagcggcaggtatctactggtttgaagacagagatgctgctactccgtttaaa
gcagaagcaacccgtacaggtaatggtacattacaataccttatttcacagccacagaag
tcatacaatgtaattggctttaattttggggaatattgccagggaactacaaaacaaaag
tatacactcgatcttacacagaatgcggtattgcagttaaccgttgcagcaccggcaacc
aatacagccacgctggacctgaagtttcagatgaaagatgcagacggaactgtaattgct
atcaacaaaacattcttaacagaaacagttgctacaaactggtataaatatgaaatcggt
ttcagcaaaaaccatcttgcacccgattatttatctttggcacccggcacaacaacaaac
ttctcgtttgatttcaaaaatacgttatcgattaaaaatccaaacaatccgaatttcccg
accgatatcaatctgaacaacacggattttgatttcagtaaagttgttgaggtagtaatt
attccggtaaataaacaggatacaggtactcctaattatgatccgcttgcatttacagac
cagaaaattattttctcgggattaaaactgggcaatccggcgttaggggttgatatctgt
acaacaccaaaagctgtaactacagcaaccaaatcgtattgccagaatgcaactaatgca
gtagcacttacagcaacaggtacagcaggccttacattgaaatggtatgcttcagcaact
ggcggggtagccaatacggttgcaccgatcccttcaacatctgttgccggtgatcagacg
tattatgtgagccaggcagtgccgggatcaagcacatgtgaaggtccgcgtacagaatta
aaagttacgattgtaccggcagcaacttctgatgccggccaggatgtgacaatcacttca
gcaacatctgcaagtctaactgctgtgggttcttcagcgggaacatggagtacatactct
gttccgacaggagcaacggtaacgttctcgccttcggcaacttcagctgctgttacggct
aatggtttaactgtaaacggtacgtacggatttgtttataccgttgccggaacaggttca
tgcgcatcagcaaaggattcagtagctgtaactaaaacggttccgccgtgcactactccg
aatgcagttactccggcagatatttcttattgcagaggttcactgaacgctgtcccatta
actgcatctggtttggctacaggcaataagttccagtggtatacaaatgctaccggaggt
gccgcatccgacaatgcaccgacgccatctactactactgccggcattactacatattat
gtaagccaggtttcaacaacaaatgccagctgtgaaagtgtacgttcaccattaaaggta
acgatcgtggcaccggcaacagccagtgcaggcaatacaatagctatttctacagaaaca
tcggttacattaaccggtacaggttctgcagtgggtacatggagcctgctgatcaaacca
acaggagcaggaacggtaacattttcaccgacaacaggcgcttctgttaccgcaagcggg
ttaaccgttgatggtacatatacatttacgtataccgttcagggaacaagcccttgcggt
gctgtggcagcttctgtgaatgtaaataaaacgagccctagctgtaccaatccggcaaca
gcgaatgcaggaaataaccagacaatttctaccgcgacatcggctacgcttacaggttcc
ggttcttccgcaggtacatggagtgtacagaataagccaggtgctgccaacgttacgttc
tccggaacaggtgcttctgttacagcaaacggattaacagcagatggtgtatatacattc
gtgtatacggtaagtgctaccagcccttgtgttgcagcaacctctactatgactgttacg
aaaacaacacctgtctgtacaaacccaacagtggcaaacgctggtatggatcagacaatt
tctactgccaatacggtaacgcttaccggaaccggtacaactgccggaacatggactgta
ttttcgaaaccagccggaacaacggttacaatcactccgtccggtactgctgcaactgtt
actgcaagcggcttaacagctacaggggtatacgaatttacctatacggtaaacggcgtg
tcaccatgtataacagcatcagacgttatgaaggttacaaagtctacaacaacggctatc
aattctgcttatttgaatgataacattgaactgtatccaaaccctgttactgaaacattg
tttattggaatggatcgcgtagaaggttctaaatcgttaacggtagtagatatgcttggt
aaaattgtttatgctgccgatgctgtatctattgcaaatattgatatgtctgatttaagc
agaggtatgtattttgtacacatcgaaacggaatcaggaaaaataacaaagtctgttatt
aaacaataa

DBGET integrated database retrieval system