KEGG   Cytophaga hutchinsonii: CHU_1154Help
Entry
CHU_1154          CDS       T00385                                 

Gene name
hat
Definition
histone acetyltransferase (EC:2.3.1.48)
Organism
chu  Cytophaga hutchinsonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1327234..1327695)
Genome map
AA seq 153 aa AA seqDB search
MDIHIKPINTFAHAEMDALYTMIFHFYEEYDPTHVITKESINDTIIHLTNHPESGSIQFV
YDAENALVGYVILIKYWSNEYQGYLLFIDELYIVPDKRSLGYGRTCITLIEKTFHDIQAL
ALEVSPKNTRAQAFYLQLGFLPNKNKTFIKIKY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggacatacacatcaaacccatcaatacatttgcacacgcagaaatggatgctttatac
acaatgatctttcatttttatgaagaatatgatccgacccatgtaattacgaaagaatcc
ataaatgataccatcattcacctgaccaatcaccctgaaagcggttccattcaatttgtt
tatgatgctgaaaatgccctggtgggatatgttattctgataaaatactggagcaacgaa
taccagggatacctgctgtttattgatgaactttatatcgttcccgataaaagaagttta
ggctatggcagaacctgtattacattgattgaaaaaacatttcacgacatacaggcgctg
gcactggaagtttcacccaaaaacacgcgggcccaggcgttctatctgcaacttggcttt
ctgccaaataaaaacaagacgttcattaaaattaaatattaa

DBGET integrated database retrieval system