KEGG   Cytophaga hutchinsonii: CHU_1210Help
Entry
CHU_1210          CDS       T00385                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00900  Terpenoid backbone biosynthesis
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01130  Biosynthesis of antibiotics
Module
chu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHU_1210 (ispE)
Enzymes [BR:chu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CHU_1210 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABG58483
UniProt: Q11VT3
Position
complement(1386976..1387788)
Genome map
AA seq 270 aa AA seqDB search
MISFPNAKINLGLSVLSKRPDGYHNIETCFYPIPWNDMLEIIPAKETVFTSSGNNIPGTS
ASNLCLKTYTLLKEKYPLSPVHIHLHKRIPIGAGLGGGSSDAAFTCKLLNDVFALKLSAA
EMEDIVRPVGSDCAFFIENTSILAHEKGDYFSHPGIVNLSGKWIYLIHPGIHVATKEAYD
GVVPNTDRKPIGDILKQPLSVWKAELVNDFERSVFEKYPAIKTLKEQMYKQGAAYAAMSG
SGSTVFGIFNTKPETFHENTSNIQSCIAPL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatctcatttccaaatgccaagatcaatcttggtttatctgttttaagcaaacgtccg
gatggataccataacattgaaacgtgtttttatccaatcccgtggaacgacatgcttgag
atcattccggcaaaagaaaccgtatttaccagttcgggcaataacataccgggaacatct
gcttctaatctgtgccttaagacgtataccctgctgaaagaaaagtatccgctctcacct
gttcacattcacttgcataaacgcatccccatcggtgcaggcctgggcggcggctcttca
gacgcagcctttacctgtaagcttttaaacgatgtgtttgcactcaaactttctgccgca
gaaatggaagatattgttcggcccgttggtagtgactgtgcattttttattgaaaacaca
tctattctggcacacgaaaaaggtgattacttttcacatccgggtatcgtgaatctaagt
ggaaaatggatttacctgatccatccgggcattcatgtggcaacaaaagaagcgtatgat
ggtgttgtacccaatacagacagaaaaccgatcggtgatattttaaaacaaccattgagt
gtctggaaagcagaacttgtaaacgattttgaacgtagtgtatttgaaaaatatccggct
ataaaaaccttaaaagaacagatgtacaaacagggtgcagcatatgcggcaatgagtggc
tccggttcaacggtattcggtatatttaatacaaaaccggaaacttttcatgaaaacaca
tccaacatacagagttgtattgccccattataa

DBGET integrated database retrieval system