KEGG   Cytophaga hutchinsonii: CHU_1246Help
Entry
CHU_1246          CDS       T00385                                 

Gene name
adhP
Definition
(GenBank) zinc-type alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00010  Glycolysis / Gluconeogenesis
chu00071  Fatty acid degradation
chu00350  Tyrosine metabolism
chu00625  Chloroalkane and chloroalkene degradation
chu00626  Naphthalene degradation
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01120  Microbial metabolism in diverse environments
chu01130  Biosynthesis of antibiotics
chu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHU_1246 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    CHU_1246 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CHU_1246 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CHU_1246 (adhP)
   00626 Naphthalene degradation
    CHU_1246 (adhP)
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CHU_1246 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABG58518
UniProt: Q11VP8
Position
1451657..1452814
Genome map
AA seq 385 aa AA seqDB search
MKAAVFHKPGHISVDTVEDPKIEKSDDIILKVTSTAICGSDLHIYDGFFPQARPLIMGHE
FMGIVEEVGNAVTHLKAGDRIVVPFPIACGHCYFCNHDMQPNCEHSNPEHYGPEGDVLSG
KGGGLFGYTDLYGGYAGGQAQYVRVPYADYSPRLVPESLSDEQVLFLTDIFPTGWSAIDW
AQLKGGETVAIFGSGPVGLMAQKAAWLKGAGRVIAIDPLNYRLAKAKMVNNVETLNPHEV
DVIEAIRAMTNGRGADVCVDAVGVEAERTFFDKVKAVVRFEKGTDKVLENCFKAVRRGGT
VTVVGVYGTPYDNFPLHTMFDKGLTVRLGQAPVQKYIDHLFTLVQNEKVVLNDIVTHVLP
LSHASHAYDIFKNKQEDCVKVILKP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtatttcataaaccgggtcatatctccgtagatacagtagaagatcct
aaaatagaaaagagtgatgatatcattcttaaagtaacgtcaacggctatctgtggctct
gatcttcatatttacgatggcttttttccgcaagcacgtccgctgattatgggccatgaa
tttatgggcattgtagaagaagtaggtaatgcggttacacatttaaaagcaggtgaccgt
attgttgttccttttccgattgcctgcggacattgctatttctgtaaccatgacatgcag
cctaattgtgaacacagcaatcccgaacattacggccccgaaggagatgtattaagcggg
aaaggcggtggtttgtttggttatacagatctttacggcggatatgccggagggcaggct
caatacgtacgtgttccgtatgcggattattcgccacgattggtgccggaatcgctcagc
gatgaacaggttctttttcttacggatatctttcctacaggttggtcagcaattgattgg
gcacagttaaaaggaggtgaaacagtagcaatctttggttcagggccggtaggactgatg
gctcaaaaggcagcctggttaaagggggcaggccgggttattgcgattgatccgttgaat
taccgtttagctaaagctaaaatggttaataatgtagaaacgctgaatccacatgaagtt
gatgtaattgaggcaatccgcgcaatgacaaatggacgaggtgcagatgtatgcgtagac
gcagttggagttgaggctgaacggacgttttttgataaagtaaaagcggttgtccgtttt
gaaaaaggaacagataaagtgcttgaaaattgttttaaagctgtacgcagaggtggtact
gttacagtagttggcgtatatggaacaccctatgataatttccctctgcataccatgttt
gataaaggacttacagtaagactgggacaagctccggtacaaaaatatattgatcattta
tttacccttgtgcaaaatgagaaagtggtattaaatgatattgttacacacgtactccct
ttgtcacatgcatcccatgcttatgacatctttaaaaataaacaggaagattgcgttaag
gtaattttaaagccttag

DBGET integrated database retrieval system