KEGG   Cytophaga hutchinsonii: CHU_1345Help
Entry
CHU_1345          CDS       T00385                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
chu  Cytophaga hutchinsonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:chu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1568115..1570133)
Genome map
AA seq 672 aa AA seqDB search
MKEKKGIALIEDDPWLEPYEAEIQDRIIRYKRAVKEIKEHYGDLLTFATGHKYYGINFDE
DERGWYYREWAPEAYEVYLTGDFNDWDRRSHPLTRNEFGVWQIFLPYDLYQKRFVHKSKI
KVQIVGANGTHDRIPAYITRVVQDTETTDFSGQLWFPQKPFEWTDRDFNLRKIKNPIIYE
AHVGMAQEKEGVGTYREFADKIVPRIRQMGYNSIQLMAVMEHPYYGSFGYHVSNFFAPSS
RFGTPEDLKYLVDRAHKFGLAVIMDVVHSHAVKNLSEGLNEFDGSDHQYFHPGDRGYHTG
WDSKLFDYGKLEVKRFLLSNLRYWLEEYHFDGFRFDGVTSMLYFDHGMKTFDSYDTYFKG
GVDFDAVTYLQLANEVTHRYLKDSITIAEDVSGMPGLSRSIRDGGVGFDYRLAMGIPDFW
IKYLKHLQDEQWNIYEMWSTLTNRRYKEKTIAYAESHDQAMVGDKTIAFWLMDKEMYFHM
QVDDPNPVIDRGIAIHKLLRLFTFALGGEGYLNFMGNEFGHPEWIDFPREGNGWSYQYAR
RQWSLVDNPKLKYQYLGAFDEAMMRLVRKTRLLAAEPAQQLNMDDHNKVIIFERNNMIFV
FNFSVSNSVFDYKFKSFAPGTFEIVLNSDDTRFGGHGRVDDTLEYHTNTEGQLSIYTPNR
SVLVFQRKEASE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaaaaaggaatcgccctaattgaagacgacccatggctggagccctatgaa
gctgaaattcaagatcgcattatccggtataaacgcgcagtaaaagaaattaaagaacat
tacggagacctgttgacatttgccacaggacataaatactatggcataaatttcgatgag
gacgagcgcggctggtattacagagaatgggctcctgaagcctatgaagtataccttaca
ggtgacttcaacgattgggacagacgttcacatccgttgacacgcaatgaatttggtgtg
tggcagatcttccttccatacgatctgtatcaaaaacgttttgttcataaaagtaaaatt
aaagtacagattgtaggtgccaatggcacacacgaccgtattccggcatacataacccgc
gttgtacaggatactgaaacaacagacttctccggacagctttggttcccgcaaaaacct
tttgaatggacagaccgcgatttcaatttgcgcaagatcaaaaatccgattatctacgaa
gcacacgtagggatggcgcaggagaaagaaggtgttggtacgtacagagaatttgcggat
aagattgttccccgcatccgtcagatgggctataacagcattcagctgatggctgttatg
gaacacccgtattatggttcatttggttatcacgtttccaatttctttgctccttcttcc
cgcttcggcacgcctgaagatctgaaatacctggtagatcgtgcacataaattcggactg
gcagtaatcatggacgttgtgcattcacatgccgtaaaaaatctgtctgaaggcctgaat
gaatttgatggcagcgatcatcaatacttccatccgggcgacagagggtatcatacgggc
tgggattctaaactatttgattacggcaagcttgaagtaaaacgctttctgctatcaaac
ctacgttactggctggaagaatatcactttgatggtttccgctttgatggtgttacttcg
atgctgtattttgatcacggcatgaaaacatttgacagctacgacacctattttaaaggc
ggtgtggattttgatgccgttacgtatttacaattagccaacgaggtaacccataggtat
ttaaaagattccattacgattgctgaagatgtaagcggtatgccgggcttatcacgctcc
atacgagatggcggtgttggtttcgattaccgtttggcaatgggtatacctgatttctgg
atcaagtatttaaaacatttgcaggatgagcaatggaacatctatgaaatgtggagcacg
ttaacgaatcgacgctacaaagaaaaaacaattgcctatgcagagtcgcatgaccaggca
atggttggcgacaaaaccattgccttctggttaatggacaaggaaatgtatttccacatg
caggtagatgatcccaatccggtgattgaccgcggcattgcgatacataagctgctgcgt
ttatttacgtttgccctgggcggcgaagggtatttaaactttatgggcaatgaattcggg
catccggaatggattgattttccaagggaaggaaacggctggagttaccaatacgcccgc
cgccagtggtcgctggtagataatcctaaattgaaatatcaatacttaggagcatttgat
gaagcgatgatgcgtctggtacgtaaaacacgattgcttgcagcagaacctgcacagcaa
ttgaatatggacgaccacaacaaagtgattatcttcgaacgcaataatatgatctttgta
ttcaatttcagtgtaagcaattcggtatttgattataaattcaaatcattcgcaccgggt
acatttgagatcgtattaaatagcgacgacacacgtttcggcggtcacggccgtgtagat
gacacacttgaataccataccaacacagaaggtcagttgagcatctatacgccaaacaga
agtgtgctggtttttcaacggaaagaagcatcagaataa

DBGET integrated database retrieval system