KEGG   Cytophaga hutchinsonii: CHU_1401Help
Entry
CHU_1401          CDS       T00385                                 

Gene name
cel
Definition
(GenBank) aminopeptidase, Metallo peptidase, MEROPS family M42
Organism
chu  Cytophaga hutchinsonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1624161..1625213
Genome map
AA seq 350 aa AA seqDB search
MDIQLLKNICETPGVPGYEQAVRSLVLKEVSHLADHVWVDNIGNVFALKKGVRNPENKKV
LVAAHMDEIGFIVSHIDEQGFVRFQTLGGFDPKTLTAQRVIVHGKQDLVGVMGAKPIHVM
SPEEKNKPAKIEDFFIDLGMKKEEVEQYISIGDTVTRERSLIEMGDCINCKSLDNRISVF
ILIETLRRLQHQDVPYDFYAVFTVQEEVGLRGAGVAAHSVNPDFAIALDTTIAYDVPGAR
PHEKCTELGKGTAIKILDSSTICDYRMVAYLKQQAQYKNIMWQPEILVAGGTDTAPLQRN
GKNGSIAGAISIPTRHIHQVIEMVHKNDVELSIQLLQAAVENLDQYNWSH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggatatccagttattaaaaaatatttgcgaaacaccaggtgtgccgggctacgagcag
gctgtacgttcattagtattgaaagaagtgagccatctggcagatcatgtttgggtagat
aatatcggcaacgtgtttgcgttgaaaaaaggtgtacgcaatccggaaaataaaaaagta
ttggtagctgcacacatggacgagatcggttttatcgtttcgcatattgatgaacagggc
ttcgtacgctttcagacgttgggcggctttgatccgaaaacattaacggcacaacgcgtg
atcgtacatggtaaacaagatctggtaggtgttatgggtgctaagcctattcatgtaatg
tcgccggaagaaaaaaataagcctgcgaagatcgaagattttttcattgatctgggaatg
aaaaaagaagaagtagagcaatatatcagcatcggcgatacggttacaagagaacgttcc
ctgattgaaatgggcgactgtattaactgcaaatcgttagataaccgcatttctgttttt
atattaattgaaacactaaggagattgcagcaccaggatgtaccatatgatttttatgcc
gtattcaccgtacaggaagaagtaggcttacgtggtgcgggagtagctgcacacagcgtt
aatccggactttgccattgccctggatacaaccattgcatacgatgtacccggcgcacga
ccacatgaaaaatgcacggagctgggtaaagggacagcgatcaaaattttagattcatca
accatttgtgattacagaatggtggcttatttaaaacaacaggcgcagtataaaaatatt
atgtggcaaccggaaattctggtagcaggcggtacagataccgcaccgctacagcgtaat
ggaaaaaacggttctattgcgggtgctatttctattcctaccagacacattcatcaggta
attgaaatggtgcacaagaacgatgtagagctgagcattcaattacttcaggcggctgtt
gaaaatttggaccagtacaactggagtcactag

DBGET integrated database retrieval system