KEGG   Cytophaga hutchinsonii: CHU_1579Help
Entry
CHU_1579          CDS       T00385                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CHU_1579 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CHU_1579 (btuE)
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CHU_1579 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1854258..1854752
Genome map
AA seq 164 aa AA seqDB search
MATVDKTQSIYSIKVTTLDGQPFDLSTLKGKKILIVNTASKCGYTPQYEELQQLHALHGD
SVAVLGFPCNDFGGQESGSESEIGAFCTKNYGVTFQMFEKVHIKGNEQHPLYKWLTDPAL
NGWNKDAPTWNFCKYLINEKGELVNFFGSGVKPMSKTVLDAIRK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgttgacaaaacgcagagtatctatagcattaaagtaacaactcttgacgga
cagccgtttgatctgagtacgctgaaaggtaaaaagattctgattgtaaatacggcttct
aaatgcggttatacacctcaatacgaagaactgcagcaactgcatgcacttcatggcgat
tcggtagctgttttaggtttcccctgcaatgatttcggcggacaggagtcaggttctgaa
agtgagatcggtgctttctgtactaaaaattatggcgttacctttcagatgtttgaaaag
gtacacatcaaaggcaatgaacaacatcctttatataaatggcttacagatcctgcgtta
aatggctggaacaaagacgctccaacatggaatttctgtaaatacctgatcaatgaaaaa
ggcgaactggttaatttctttggctcaggtgttaaaccaatgagtaaaacagttcttgac
gcgatcagaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system