KEGG   Cytophaga hutchinsonii: CHU_1581Help
Entry
CHU_1581          CDS       T00385                                 

Gene name
glgA
Definition
glycogen synthase, glycosyltransferase family 3 protein (EC:2.4.1.21)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
chu  Cytophaga hutchinsonii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHU_1581 (glgA)
Enzymes [BR:chu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CHU_1581 (glgA)
Glycosyltransferases [BR:chu01003]
 Polysaccharide
  Storage polysaccharide
   CHU_1581 (glgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1855558..1857372
Genome map
AA seq 604 aa AA seqDB search
MNTNYSDCLLTEVAWEVCNQVGGIYTVIRSKVPTMTEVWGDRYCLVGPYFHNKAIAEFEA
IDTYEADDVFAQAVLRMRNLGYEVHYGHWLVSGRPKVVLINHFSAFYRLGEIKYSLWENH
GISSPEGDDLLNQVIAFGFLAKVFHQQLDETKGELPCVSHFHEWMTGTAIPEMRREHVKT
SIVFTTHATLLGRYLAMNDPNFYDNLPYYDWNKEAVNFNIEPAVKIERAAAHGANVFTTV
SEVTARECQSLLGRNPDMVLPNGLNIERFTALHEFQNLHKEHKDQIHEFVIGHFFQSYTF
DLDKTLYFFTSGRYEYKNKGFDITLEALARLNWRLKEENTDTTVVMFFITKQPYHTINPQ
VLQSRAVMEEVRSNCDAIVQQLGDKLFEAAASSGDLKLPDLNKFVDEYWKLRLRRTLLSW
KSHELPKVVTHNLVYDNQDEILNFLRHSNMVNNEHDKVKVVYHPDFIASTNPLFGMEYGQ
FVRGCHLGVFPSYYEPWGYTPLECMASGVPAITSDLSGFGDYVLKNIPNNENKGIYVTNR
FHKSYHDAAQQLADQMYHFVHLSRRDRITQRNRVESASEHFDWQNLGSYYDKAHRLAFSI
AVNA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaacactaattattctgactgtttattaaccgaagtagcctgggaagtatgtaatcag
gtaggtggtatctataccgttatccgttcaaaagtacctaccatgactgaagtatggggc
gatcgctactgtttggttggaccgtattttcacaacaaagccattgctgaatttgaagcg
attgatacctacgaagctgatgatgtttttgcacaggctgtattgagaatgcgcaactta
ggttatgaggttcattacggacactggctggtatcaggccgtccgaaagttgtattgata
aatcatttctctgcattctaccggttaggtgaaattaaatacagcctttgggaaaaccac
ggaatctcaagtccggaaggggatgacctgttaaatcaggtaattgcttttggtttcctt
gcaaaggtgttccatcagcaattggatgaaacaaaaggagaacttccatgtgtatctcat
ttccacgaatggatgacaggtacagcgattcctgaaatgcgccgcgaacatgtaaaaaca
tctattgtatttacaacccacgccaccttattgggccgctacctggccatgaatgatccg
aatttctatgacaacttaccttattacgattggaataaagaagcggtcaattttaatatc
gaacctgcagtaaaaatagaacgcgctgccgcacacggcgcgaacgtatttacaaccgta
agtgaagtaacagcccgtgaatgccagtcgttactgggcagaaacccggacatggttttg
cccaacggtttgaacattgaacgtttcactgccttacacgaattccagaatttacacaaa
gaacataaagatcagatccatgaatttgtgatcggtcacttttttcaaagctatacgttt
gacctggataagaccttatacttctttacttccggaagatatgagtacaagaataaaggc
ttcgacattacgcttgaagcgcttgcccgtttaaactggagattaaaagaagagaacacc
gatacaacggttgtgatgttctttattaccaagcagccataccataccattaacccgcag
gtattacaatcacgcgcggtaatggaagaggtgagaagcaactgcgatgcaattgtacag
cagctgggcgataaattgtttgaagcggctgcatccagcggcgacttaaaattaccggat
ttaaataaatttgtagacgaatactggaagctgcgtttaagaagaaccttgctatcctgg
aagtcgcatgaattgccaaaggttgttacacacaatttagtgtacgacaatcaggatgaa
attctgaacttcctgagacattccaatatggtaaacaatgaacacgataaagtaaaagtt
gtttatcacccggacttcattgcaagcaccaatcccttgtttggcatggaatacggacag
tttgtacgcggttgccatttaggtgtgttcccaagttactacgaaccatggggctatacg
ccgcttgaatgtatggcatccggtgtgcctgcaatcacatccgatttatccggattcggt
gactacgtattgaaaaacattccgaataatgagaacaaaggtatctacgtaacaaaccgc
ttccataagagttaccacgatgctgcacagcagctggcagaccagatgtatcactttgtt
cacctctcccgcagagaccgtataacgcaacgtaacagagtggagagtgcatccgaacat
tttgactggcagaacttaggaagctattatgataaagcgcatcgtttggctttctctatt
gcagtgaacgcttaa

DBGET integrated database retrieval system