KEGG   Cytophaga hutchinsonii: CHU_1595Help
Entry
CHU_1595          CDS       T00385                                 

Definition
(GenBank) fatty acid desaturase (stearoyl-CoA desaturase)
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu01040  Biosynthesis of unsaturated fatty acids
chu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CHU_1595
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CHU_1595
Lipid biosynthesis proteins [BR:chu01004]
 Desaturase
  First
   CHU_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Lectin_leg-like
Motif
Other DBs
NCBI-ProteinID: ABG58865
UniProt: Q11UQ1
Position
complement(1869807..1870568)
Genome map
AA seq 253 aa AA seqDB search
MTGTAWPIIIFFVAHWYLSLFSQTFFLHRYSAHAMFKMNKFWEKFFFIFLYLTQGSSYLV
PRAYGALHRMHHAYSDTEKDPHSPLYSRNAFVMMWKTKDIYNAVLRREAQVEDKFNKNLP
EWAFIDNIGDMWISRIIWGTLYVLFYIYFVPADMWYLYLLLPIHFLMGPVHGAIVNWFGH
KLGYQNFDNKDASRNTLALDVLLGGELFQNNHHMYGSRPNFAMKWFEFDPTYPVIKVLHY
VRIIRLVNPDAKA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgactggtacagcctggcccattattatattctttgttgcgcattggtatttatctttg
ttcagccaaacattctttctgcacagatattctgcgcacgcaatgtttaaaatgaataaa
ttctgggagaaattcttctttatattcttatacctgactcaaggttcttcttacttagtt
ccaagagcctatggcgcacttcacagaatgcaccatgcctatagtgatacagaaaaagat
ccacactctcctctttattcaagaaatgcatttgttatgatgtggaaaacaaaagacatc
tacaacgctgtattaagaagagaagcacaagttgaggataagttcaataagaaccttcct
gaatgggcattcatcgataacattggtgatatgtggatctccagaattatttggggaaca
ttatatgtattattctacatttattttgttcctgctgatatgtggtatttatatttatta
ttaccaatccatttcttaatgggacctgtacacggtgctatcgttaactggtttgggcat
aaattaggttatcagaactttgataacaaagatgcttccagaaacacacttgctctggat
gtactgttaggtggtgaattatttcagaacaatcaccatatgtatggcagcagaccaaac
tttgcaatgaagtggtttgaatttgatcctacctatccggtaataaaagtattgcattat
gtacgcatcatacgtctggttaatccggatgctaaagcgtaa

DBGET integrated database retrieval system