KEGG   Cytophaga hutchinsonii: CHU_1600Help
Entry
CHU_1600          CDS       T00385                                 

Gene name
pfkB
Definition
6-phosphofructokinase II (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHU_1600 (pfkB)
   01230 Biosynthesis of amino acids
    CHU_1600 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHU_1600 (pfkB)
   00030 Pentose phosphate pathway
    CHU_1600 (pfkB)
   00051 Fructose and mannose metabolism
    CHU_1600 (pfkB)
   00052 Galactose metabolism
    CHU_1600 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CHU_1600 (pfkB)
Enzymes [BR:chu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHU_1600 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1875714..1876649)
Genome map
AA seq 311 aa AA seqDB search
MKSSIFTLTLSPAFDKSTSVESVQPEHKLRCDSPIYQPGGGGINVSRAIKKLNGSSVALY
PIGGDTGNHFKALLTEEGIEQITFQIKNWTRENFIVVERSTNNQFRFGMPGSEIYKEEWE
QMLAVIQDPSNDFEYFVVSGSTPKGVPDEFYTRLSQIILQKNARLILDTSGAALKHCLKE
GIFLCKPNINELSEIVGKELITKEQQEAAAMEIINSGKVEILVVSLGGAGAFLASKQGIY
HVTAPPVEKRSTVGAGDSMVAGMVLSLSRGNHYEDVIKFGVACGTAATMNFGTELCKLED
VERLYKQLGGK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttcgatttttacactaacacttagtcccgcttttgataaaagtacgtcagtg
gaaagtgtacaacctgagcataaattacgttgcgacagcccgatttatcaacctggtggt
ggcggtattaatgtttcccgtgcaattaaaaaattaaacggaagttctgtagccctttat
cctattggcggagatacgggcaatcattttaaagcattattaactgaagaaggaattgaa
cagattacttttcagataaaaaactggacacgcgaaaatttcattgttgtggaacgttct
acaaataatcaattccgtttcggcatgccgggttcagaaatatataaagaagaatgggaa
caaatgcttgctgtgattcaggatccttcaaacgattttgaatattttgttgtgagcggc
agtacgcctaaaggtgttcccgatgaattctatacccgtttatctcagatcattcttcag
aaaaatgcgcgtcttattttagatacttccggagcagccttaaaacactgcctgaaagaa
ggaatatttttgtgtaagccaaacattaatgaattaagtgaaattgtaggcaaagaactt
attacaaaagaacagcaggaagctgccgcgatggaaattatcaatagcggtaaagttgaa
atcctggttgtatccttaggtggtgccggagcattcctggcgtctaaacaaggtatctat
catgtaactgctccgcccgttgaaaaaagaagtacagtaggtgccggagacagtatggtt
gcgggcatggtattaagtttatcccgaggcaatcattatgaagatgtgatcaaattcggc
gtagcatgcggtacagcagcaacaatgaatttcggtacagagctttgtaaattagaagat
gtagaaaggttgtataagcaacttggcggaaaataa

DBGET integrated database retrieval system