KEGG   Cytophaga hutchinsonii: CHU_1655Help
Entry
CHU_1655          CDS       T00385                                 

Gene name
cel
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
chu  Cytophaga hutchinsonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:chu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1938050..1940614
Genome map
AA seq 854 aa AA seqDB search
MTKNMKKIGLFISIVFSSLLANAQTGTGDDFDRAGTGTTGMDAGAAWVQTGTADEQYKLY
LYGNELVVQCKDGGLNYIGFGYQFSPIDIMDAPLVSVKIKSSYGYVMRVDLIDANGRRTN
QIDTKQTIKSDGKYNDYLFDFTGRFYQQYGTNNGPVDATQIVRMEFITDPKGNLGVGQGF
NKNFTMDSVMIGTRAKSTIVTGARGIKLNQIGFFKEGQKKAVINGASAATFTIVNEANTV
VYSGNLSATATWTYSGESVRIADFSNFKTPGKYRLMAPGIPNASYPFVISNTPLSAISKA
SVKGFYYQRASTALPATYAGIWSRAAGHPDNQVEIHNSAVSPGRAAGSKISSPRGWYDAG
DYNKYIVNSGISTYTLLAAYEHFSTYYDTLNLNIPESANSVPDVLDEALYNIRWMLTMQD
PYDGGVYHKLTNANFDGDIMPSAATQKRYVVQKSTGATLDFAAVMAQSARIYSKFPTQLP
GLADSCIKAAKKAYDWAILNPNIFYVQENLTSPAITTGTYDDWSFADEQSWAAAELFTTT
LSSEYYNDINLSSGASIPGWQNVYTLGLISMAHNRVVLGDNSDSTFIKNKIVTLANVYRD
HFATGSAYGIAMGANGGFGWGSNSQAANQSMILIQAFNYTKDSSYLKAAVSNVDYILGRN
GVNYCFVTGSGSLGANRPHHRVSQADGIAPAVPGLLVGGPNSGQQDNCPGYPSSQPALSY
VDSECSYSTNEIAINWNAPLAYITGAIQSIYAGIEPSKRDYTVDTPTSTRDAILKNTFIN
IYPNPAASSITVVKPFEITAKPIILDLNGREYPVTGDWSTTDIQLNLSDLKAGMYLIRLQ
GENGAAVQKFTVIK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaatatgaaaaaaataggtttatttatttcaatagtgtttagttcactgctt
gcaaatgcgcaaacgggcaccggagatgatttcgatagagccggaacgggaacgacgggc
atggatgccggagctgcctgggtacaaaccggaactgccgatgagcaatataaactttat
ttatatggaaatgaattggttgtacaatgcaaagacggtggattaaattatatcggattt
gggtaccagttttcaccaatagatattatggatgcaccattggtttctgtaaaaattaaa
tcttcctatggttatgtaatgcgcgttgatcttattgacgcaaacggccgcagaacaaac
cagatagatacaaaacaaacgattaaatctgatggtaaatacaatgattatttatttgat
tttacaggccggttttatcagcaatacggaaccaataacggtccggtagatgctactcag
attgtacgtatggaatttattacagatcctaaaggcaatttaggcgttggtcagggtttt
aacaaaaactttaccatggatagtgtaatgattggtacaagagcaaaatcaaccattgtt
acaggagcaagaggtattaaattaaatcagattggtttctttaaagaaggccagaaaaaa
gcagttatcaatggagcatccgctgcaacatttacaatagtaaacgaagcaaacaccgtt
gtatattccggaaatctttcagcaacagcaacatggacgtattcaggagaatctgtacgt
atagcggacttcagtaattttaagacacctggaaaatatcgattaatggcaccgggaata
ccaaatgcatcctatccatttgttatttctaataccccgttaagcgcaatttctaaagcc
agtgttaaaggattttattatcagcgtgcatcaacggcattgcctgcaacatatgcgggt
atttggtcaagagctgccgggcatccggataatcaagtagaaattcacaactcggctgtt
tcaccaggaagagctgcgggatctaaaatttcttctccacgaggttggtacgatgcaggt
gactacaataaatacattgtaaattcaggtatttcaacatacacgctattggctgcatat
gagcatttttcaacctactatgatacacttaatttaaatattcccgaaagtgcaaactcc
gtaccggacgttctggatgaggcattgtataacattcgctggatgttaaccatgcaggat
ccatatgatggcggcgtgtatcataaattaacaaatgctaattttgatggggacattatg
ccaagtgctgctactcaaaaaagatatgttgtacagaaaagcactggagcaacattagat
tttgcagcagttatggcgcagtctgcccgcatttattctaaatttccaacacaattaccc
gggctggcagattcttgcataaaagctgctaaaaaagcatatgattgggcaattctaaac
ccaaatattttctacgtacaggaaaacttaacgagtcctgctattacaacaggtacgtat
gatgactggagttttgcggatgaacaaagctgggcggcagcagaattatttactacaaca
ttatcctctgaatattacaacgatattaatttatcttccggcgcaagcataccaggctgg
cagaatgtatacacgctgggtttaatttccatggcgcataatcgtgttgtattaggagac
aattcagattcaacatttattaaaaataaaattgtaaccttagcaaatgtttatagagat
cattttgctacaggatctgcatatggtatagcaatgggcgctaacggaggttttggatgg
ggaagtaattctcaggcagctaaccaatctatgattttaattcaggcatttaactacaca
aaagacagttcttatttaaaagcagcggtgtcaaatgtagattacatcttaggtagaaat
ggtgtgaattattgttttgtaacaggttcaggaagccttggcgcaaacagaccacatcat
agagtgtcacaggcagatggtattgcaccagctgtaccgggcttattggtaggcgggccg
aattcaggtcagcaggataattgccctgggtatccatcttcacaacctgccttatcttat
gtagacagtgaatgtagttattcaacaaatgaaattgctattaactggaatgcaccgctt
gcttatattactggtgcgatacaaagtatctatgcaggtattgaacccagcaaacgtgat
tacaccgttgatacacctacatcaaccagagatgctatattaaaaaatacattcattaat
atttatcctaatccggcagcatcaagcataacggttgtaaaaccgtttgagataactgcc
aaacctattattcttgatcttaacggcagagaatatcctgtaaccggagactggtcaaca
actgacattcaacttaatttatctgatttgaaagcaggtatgtatcttatccgtttacaa
ggagagaatggtgcagccgttcagaaattcactgtaattaagtaa

DBGET integrated database retrieval system