KEGG   Cytophaga hutchinsonii: CHU_1753Help
Entry
CHU_1753          CDS       T00385                                 

Gene name
dfr
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
chu  Cytophaga hutchinsonii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHU_1753 (dfr)
   00670 One carbon pool by folate
    CHU_1753 (dfr)
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CHU_1753 (dfr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2059678..2060226)
Genome map
AA seq 182 aa AA seqDB search
MRKVIAAINMTIDGYCDHTAVNPDAEIHQHYADLLHNTGVAVYGRVTYQLMQYWQSIRAN
PTGKKATDEFAAAIDRVPKLVFSHTLKDTGWNSATLAKGSLEEELTALKQQPGKDIYVCS
PGMIVAAMNLNLIDEFQLCVHPVVAGSGLPLFKNIQDKPMFRLVQTKNFTSGAVILYYEP
LK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtaattgcagccatcaacatgacgattgatggatattgcgaccatacagca
gttaatccggatgcagagatccaccagcattacgcagacctgctgcataacaccggcgtt
gccgtgtatggcagggttacataccagctgatgcagtactggcaaagcatacgggcaaac
cctacgggtaaaaaagctacagatgaatttgcagctgccatcgaccgcgtacctaaactt
gtcttttctcatacgctgaaggatacaggttggaatagtgcaacgctggcaaaaggaagt
cttgaagaagagcttacagcacttaaacagcagccgggtaaagatatttatgtgtgcagt
ccgggtatgattgtagctgctatgaatctgaatttaattgatgaatttcagctctgtgtg
cacccggttgttgcaggcagtggtttgcctctatttaagaatatccaggataagcctatg
ttcagattggtacagacaaaaaactttacatccggtgcggttattttgtattatgagccg
ctgaaataa

DBGET integrated database retrieval system