KEGG   Cytophaga hutchinsonii: CHU_1755Help
Entry
CHU_1755          CDS       T00385                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase (dihydrolipoamide S-acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00010  Glycolysis / Gluconeogenesis
chu00020  Citrate cycle (TCA cycle)
chu00620  Pyruvate metabolism
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01120  Microbial metabolism in diverse environments
chu01130  Biosynthesis of antibiotics
chu01200  Carbon metabolism
Module
chu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHU_1755 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CHU_1755 (pdhC)
   00620 Pyruvate metabolism
    CHU_1755 (pdhC)
Enzymes [BR:chu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CHU_1755 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABG59022
UniProt: Q11U92
Position
complement(2061080..2062744)
Genome map
AA seq 554 aa AA seqDB search
MAELIKMPKMSDTMTEGVIAAWHKKVGDKVKSGDLLAEVETDKATMEMESYEDGTLLYIA
AEAKSAVPIDGVIAVIGKDGENIDALIKEIKGGGAPAEAPKTEAKAEAEVPKAEKPAEAA
KQAAPAVDLSSIKAEAILMPKMSDTMVEGTIVAWHKKVGDAVKSGELLAEVATDKATMEM
ESYEDGTLLHIEVKEGDAVQIDGLIAIIGEKGTDVTPIINAYKNGGKPSAAPAAASEPAK
QETASAPASNNAPAAQASSSSDERAKISPLARKIASDKGIDIKQVKGSGDHGRVIKRDIE
NFKAAPAEAAPAKGSGAPAASLPNIVGQEGFDEVPVSQMRKVIVKRLSESLFTAPHFYLT
MEINMDKAIEARASINEVATAKVSFNDMVIRASAAALRKHPMVNASWQGDKIRVNHHIHI
GVAIAIEDGLVVPVVRFADSKSLSHISQEVKELGGKAKSKKIQPADMAGNTFTISNLGMF
GIDEFTSIINSPDACILSVGGIKQTPIVKNGQIVVGNIMKVTLACDHRVVDGAVGSAFLQ
TLKSYLEDPVRILA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattgattaaaatgcctaaaatgagcgataccatgacagaaggtgttatcgcg
gcatggcacaaaaaagtaggagataaggtgaaatccggagaccttttagcagaagttgaa
acggataaggctaccatggaaatggaatcttatgaagacggaacactcctatatatagca
gctgaagcaaaaagtgcagtacctattgatggtgtaattgcagtaattggtaaagatggt
gaaaatattgatgctttaattaaagaaatcaaaggtggcggtgcaccagctgaggctcca
aaaacagaagctaaagcagaagcagaggtaccaaaagctgaaaagcctgcggaagcggct
aaacaggctgcacctgcagtagatctttcttctatcaaagcagaagcgatcttaatgcct
aaaatgagtgatacaatggttgaagggacaattgtagcatggcataaaaaagttggagat
gcagttaagtctggtgagttacttgcagaagtagctactgataaggctaccatggaaatg
gaatcttatgaagacggaacacttcttcacattgaagtaaaagaaggagatgcggttcag
atcgacggcctgattgccattattggtgaaaaaggaacagatgtaacaccgatcatcaac
gcatataaaaacggcggtaagccatctgcagctccggcagcagcaagcgaaccggctaaa
caggaaacagcttctgcacccgcatcaaacaatgctcctgcagcacaggcttcttcctct
tcagatgaaagagccaagatttctccgctggcacgtaaaattgcttcagacaaaggaatc
gatatcaaacaggttaaaggttcaggagatcacggccgtgttataaaacgcgacattgaa
aactttaaagcggctccggctgaagcagctcctgctaaaggttccggcgctccggcagct
tcattaccaaacatagttggtcaggaaggctttgacgaagtaccggtttcacaaatgcgt
aaagtaatcgtgaaacgtttatctgaaagcttattcactgctccgcacttctatttaacc
atggaaatcaacatggataaagcgatagaagcacgtgcaagcatcaatgaagtagctaca
gcgaaagtttcattcaatgatatggtgatccgtgcaagtgcagcagcgcttcgcaaacac
ccgatggtgaacgcttcgtggcagggagacaaaatccgtgtgaaccaccacattcacatt
ggtgttgccattgctattgaagatggacttgttgttccggtagtacgtttcgcagattct
aaatccttgtctcatatttctcaggaagtaaaagaacttggcggtaaagcaaagagcaaa
aaaatacagcctgcagacatggccggcaatacattcacgatctctaacttaggtatgttt
ggtattgatgagtttacatcgatcatcaactctccggatgcatgtatcttatccgtaggc
ggtatcaaacagactccgatcgttaaaaacggacagattgtagttggtaacatcatgaaa
gtaaccttagcgtgcgatcaccgtgtagtagatggtgcagtaggttcagcgttcttacag
acattaaaaagctaccttgaagatccggtacgtattcttgcgtaa

DBGET integrated database retrieval system