KEGG   Cytophaga hutchinsonii: CHU_1842Help
Entry
CHU_1842          CDS       T00385                                 

Gene name
cel
Definition
(GenBank) candidate retaining b-glycosidase, glycoside hydrolase family 5 protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00500  Starch and sucrose metabolism
chu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHU_1842 (cel)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CHU_1842 (cel)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_4_9
Motif
Other DBs
NCBI-ProteinID: ABG59109
UniProt: Q11U05
Position
complement(2160209..2161864)
Genome map
AA seq 551 aa AA seqDB search
MTIRTIFILIAACSIAIACRKKHDDESTSIDSRQLHASGIDIIDGSGKKVYLRGVAFGNE
VWSNAPTIPTTHHSEEDYKRVRDMGMNAIRFYLNYQIFEDDATPYVYKSAAWDWIDQNIA
WAKKHDIYLILNMHVPQGGFQSNGDGDALWNNPENQNRLKALWFNIAKRYANEPTIAGLD
LLNEPVVTTSIDQWKNFSQSIIDTIRTVNTNSMIIVERVNAIDDNWSNNSDMNFFDLNDN
NLAYEFHFYLPMEFTHQGASWIGGGNTFPIGQTYPDANRVFVKGNSFFYTASFANARIPT
GTYDWMEYAESPKYKIQDEKIKLGKPTVVNRANTGKIWVDDIVVKEYDASDNFVRNVFEI
DLNTFDGWYSWSENGSGTAGADAATGHSNSNSLYMQGTTGDANISSTAYQFIPKQGYSYT
ISGWVKGEDVTAGSAAMFRLDFEQIADGDNVYSLGKEYLAAQVDQYYKWTHIKNKPLFLG
EFGVIQFGYENNLGGLQWTGDMIDILKERDAHFTYHAYHEDSFGIYKGYGTPVDPSTGNQ
ALINLFKSKLP
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgactatcagaacaatctttattttaattgccgcatgttcaatcgcgattgcctgccgt
aaaaaacatgacgatgaatccacatccattgatagcaggcaattacatgccagtggaatt
gatattattgatggcagcggtaaaaaagtatacttgagaggcgtagcatttggaaatgaa
gtatggtctaatgcacctaccattccgacaacgcatcattcagaagaagattataagcgc
gtgcgcgatatgggtatgaatgccatacgtttttacctgaattatcagatttttgaagat
gatgctactccgtatgtatataaatctgcagcgtgggactggatcgatcagaatattgcc
tgggcaaaaaaacatgacatttatttaattctcaatatgcatgtgccccaaggcggcttt
caatctaacggagatggtgatgcgttatggaacaatcccgaaaaccagaaccggttaaag
gcgttgtggtttaatattgccaaacggtatgcaaatgaaccaaccattgccggacttgat
ctgctgaatgagcccgtagtaacaacatccattgatcaatggaaaaacttttcacagtca
attattgataccatccgtacggtaaacaccaacagcatgattattgtggagcgggtgaat
gcgatagatgataactggtcaaataattcggatatgaatttttttgacctgaatgacaac
aatcttgcatatgaatttcatttttatttgccgatggaattcactcatcagggggcaagc
tggatcggaggaggcaacacatttccgatcggacaaacctatccggatgccaacagggtt
tttgttaaaggcaattcttttttttacaccgcatcttttgcaaatgcccgcataccaaca
ggtacctacgattggatggaatatgctgaatcacctaagtataaaatacaggatgaaaaa
ataaaactgggcaaaccaacagttgtaaaccgtgccaatacaggtaagatatgggtagat
gatattgtagtgaaggagtatgatgcatcggataattttgtacgtaatgtatttgaaata
gatctgaatacatttgacggctggtattcatggagtgaaaacggatctggtactgcaggc
gctgacgctgctacagggcattcaaattcaaactcgctatacatgcaggggacaaccggc
gatgccaatataagcagtactgcctatcagtttattcccaaacaaggttattcctacacc
atcagcggctgggtaaaaggagaagatgtgacagctggttctgctgccatgttccgcctg
gattttgaacagattgctgatggagacaatgtatattcattgggaaaagaatatttagcg
gcacaggtagatcaatattataaatggacacacatcaaaaacaagcccttatttttaggg
gagttcggagtgattcagtttggttatgaaaataatctaggcggcttgcagtggacgggt
gatatgattgatatccttaaagaacgggatgcccattttacataccatgcctatcatgaa
gattccttcggtatttataaaggctacggtactcctgttgatccttcaacgggcaatcag
gcgctcattaatttattcaaatcaaaactcccttag

DBGET integrated database retrieval system