KEGG   Cytophaga hutchinsonii: CHU_1875Help
Entry
CHU_1875          CDS       T00385                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHU_1875 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHU_1875 (glk)
   00052 Galactose metabolism
    CHU_1875 (glk)
   00500 Starch and sucrose metabolism
    CHU_1875 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CHU_1875 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CHU_1875 (glk)
   00524 Butirosin and neomycin biosynthesis
    CHU_1875 (glk)
Enzymes [BR:chu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CHU_1875 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2194126..2195034)
Genome map
AA seq 302 aa AA seqDB search
MILGIDVGGTSVKFGLVTPEGEIQNATRFMTADWVNGIGFVESMKLEIGNFLKQYPIVKG
VGIGWPGLVSLDRTKVILLPNIPSVVNVPIVEILRSEFPHIHFKIENDAKCAALGEYYFG
ENKRMQTFILLALGTGVGSGVMMNGKLFIGGRGNGTEVGHMLTTRGKSLENQVGINHLIA
YTHEQLALDVAKKSSLHTIAELSPKVIADHAAQGDALALAVWADIGTIIGESLVNIVRVM
DLNNILLGGGISGAFDYFVPNLKKAMLEHLPTYYTDDMYIGKATLENDAGLLGAAGLIME
AI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgattttaggaattgacgtaggtggaacttcggtaaaatttggtttggttactcctgaa
ggagaaatacaaaacgctacacgttttatgacggccgactgggtaaacggtattggtttt
gttgaatcgatgaagctggaaataggaaattttttgaaacaatacccaatagtaaaaggt
gttggaatcggctggccgggtttagtttctctggaccgcactaaagttatcctgctaccg
aatatcccttctgtggtaaatgtgcctattgttgagatcctgcgttcagaatttccgcat
atccattttaaaattgaaaacgatgcgaaatgcgctgcattgggtgaatattattttgga
gaaaacaaacgcatgcagacctttattctacttgcgttgggtacaggagttggttccggt
gttatgatgaacggcaagctgtttatcggcggccgtggtaatggtacagaagtggggcac
atgcttacaacaagaggcaagtcattggaaaatcaggttgggatcaatcatctgatcgcc
tacacacatgaacagctggcattagatgtagcaaagaaaagcagcttacatacaatagct
gaattatctccgaaagtaattgcagatcatgctgctcagggcgatgctttggcattggct
gtatgggcagatatcggtacaattatcggtgaaagtcttgtgaatattgtacgagtaatg
gatctgaataatattttattaggcggcggtatttcaggagcctttgattatttcgttccg
aatctgaagaaagcaatgctggaacatttgccaacatactatacagatgatatgtacatc
ggtaaagctacgctagagaacgatgcaggcctgctgggtgctgccggactgatcatggaa
gcgatataa

DBGET integrated database retrieval system