KEGG   Cytophaga hutchinsonii: CHU_1928Help
Entry
CHU_1928          CDS       T00385                                 

Gene name
pcm
Definition
L-isoaspartyl protein carboxyl methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
chu  Cytophaga hutchinsonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2258938..2259603
Genome map
AA seq 221 aa AA seqDB search
MEDSYLHKGLRRKLIKILRDKGIQDELVLQAIDRVPRHIFLDNAFLEHAYQDKAFPIGDG
QTISQPYTVASQTSLLKLSPGMKVLEIGTGSGYQCSVLLEMGVNVFTIEYHKSLFEKSKK
MLQSLGYKAQFFCGDGSEGLARFGPYDRILATAGAPYVPQKLLEQLKVGGILVIPVGDQK
TQKMLRLTKVTEKEITQEECGDFRFVPLVGKDGWNAKTNKL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtggaagattcctatttacacaaaggactacgaagaaagctcattaagatactaagagac
aagggtattcaggatgaattggtattacaggccattgatcgggtaccccggcatattttt
cttgacaatgcttttttagaacacgcctatcaggataaagcttttccaattggtgatgga
caaaccatttctcaaccctatacggttgcctctcagacaagcttgctgaagctgagtccg
ggaatgaaagtacttgaaatcggtacaggttccggttatcaatgttctgttcttcttgaa
atgggtgtaaatgtttttaccattgaataccataaaagtctgtttgagaaatcaaaaaaa
atgcttcagtcgcttggctacaaagctcagttcttttgcggagacggcagcgaaggttta
gcgcgcttcggcccgtatgaccgtatacttgctactgccggcgcaccgtatgtgccgcaa
aagttattggaacagttaaaagttggcggcatattggttattccggttggagatcagaaa
acacaaaaaatgctgcgcctcactaaagtaactgaaaaagaaatcacacaagaagagtgc
ggcgacttccgttttgtaccattggtaggcaaagacggctggaacgctaaaacaaataaa
ttatga

DBGET integrated database retrieval system