KEGG   Cytophaga hutchinsonii: CHU_2078Help
Entry
CHU_2078          CDS       T00385                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
chu  Cytophaga hutchinsonii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:chu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CHU_2078 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CHU_2078 (cheB)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CHU_2078 (cheB)
Two-component system [BR:chu02022]
 CheA family
  CheA-CheYBV
   CHU_2078 (cheB)
Bacterial motility proteins [BR:chu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CHU_2078 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2425499..2426092)
Genome map
AA seq 197 aa AA seqDB search
MKSNAESNREFSAIVIGVSAGGLHALIQVLGKLPADYVIPIIVVQHRGKEYKDLLEDVLQ
TKCLLKIKQADEKESIEPAHIYIAPADYHLLIEHDKTFSLTSDMYVKHSRPSIDLLFTTA
AEVYKEKLLGIILTGASSDGAEGMREIRRVGGLTIAQDPLTAEYPYMPQASINIGAIDTI
LTLDEITSFLMRIYERG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaacgcagagagtaaccgggaattttctgcaattgttattggtgtgtctgcg
ggtggcctgcacgcacttattcaagtacttggaaaacttccggctgattatgttatcccc
attattgttgtacagcatcgcggaaaagaatataaagatcttctcgaagacgtactgcag
actaaatgtttgctgaagataaaacaggcagatgaaaaagaatccattgaaccggcacat
atttacattgcaccggctgattatcatttgcttatagaacatgataaaacattttcacta
acttcagacatgtatgtaaaacacagccggccgtctattgacctgttgtttacaacagcg
gctgaagtgtataaagaaaaacttttgggtattatactcacaggagccagtagtgacggc
gcagaaggtatgcgggaaataagaagagtgggaggtcttactattgctcaggatccgctt
acagctgaatatccgtacatgccacaggcttcaataaacatcggggccattgacactatt
ttgacattggacgagattacgtcctttttaatgcgtatttatgaaagagggtaa

DBGET integrated database retrieval system