KEGG   Cytophaga hutchinsonii: CHU_2103Help
Entry
CHU_2103          CDS       T00385                                 

Gene name
cel
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
chu  Cytophaga hutchinsonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHU_2103 (cel)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CHU_2103 (cel)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2448305..2449345)
Genome map
AA seq 346 aa AA seqDB search
MIKKISVVLVLLTGMLLSASVFAQKTIVEKYGKLSVKGNYMVGQYGDTVQLRGMSLFWSQ
WMGQYYNSDVVKWLRDDWKCTVVRAAMGVEMDGYLENPDTEKMKVMEVVNAAIAKGIYVI
IDYHSHEAQKNPAAAQRFFSEMAKKYGNIPNIIYEVYNEPLQATSWNKDIKPYAEGVITK
IRVYDTTNIIVVGTRQWSQLVTEAAANPITRQNIMYTLHFYPGTHKQELRNEAQKALDMG
IALFVTEYGTCDASGNGNFSPEETALWYEFLDAHKISYCNWSIADKPETASAIVPAASPY
GGWADYDLTPSGKLVRDDLRLKNGPIFDSLVKTSTGGVSKKKSKTK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatatccgtagtgcttgtccttcttacaggcatgttactttccgcttcg
gtttttgcacaaaagacaatcgttgaaaaatacggtaagttgtctgtaaaaggaaattat
atggttggccagtacggtgataccgttcagctgagaggcatgtctttattctggagtcag
tggatggggcaatactacaattcagatgtggtaaagtggctgcgcgacgattggaaatgt
accgtagtacgtgctgcaatgggcgtggaaatggacggataccttgaaaatccggataca
gaaaaaatgaaggtgatggaagtggtgaatgctgctattgccaaaggcatttatgtgatc
attgattaccacagccacgaagcgcagaagaatcctgcagcggcgcaacggttcttttct
gagatggcaaaaaaatacgggaacattcccaatattatttatgaagtttataatgaacca
ctgcaggcaacttcctggaataaggacataaagccgtatgcagaaggtgtcattacaaaa
atacgtgtgtatgatacaacaaacattattgtggtaggaacaagacaatggtcgcagctg
gtaacagaggcggcagcgaatccgatcacccgtcagaacatcatgtatacccttcatttt
tatccgggtacgcacaagcaggaattgcgtaatgaagcacaaaaagcattggatatgggt
attgccttatttgttactgaatatggtacctgcgatgcatcgggtaacggaaatttcagt
ccggaagaaactgctttgtggtatgaatttctggatgcccacaagatcagttattgcaac
tggtccattgcggataagcccgaaaccgcttcagctattgtaccggcagcaagtccgtat
ggtggctgggctgattatgatcttacaccgtcgggcaaattagtacgcgatgatctgcgc
ttaaaaaatggacctatctttgactcactggtaaagaccagtactggcggagtgtctaaa
aagaaatcaaaaacaaaatag

DBGET integrated database retrieval system