KEGG   Cytophaga hutchinsonii: CHU_2275Help
Entry
CHU_2275          CDS       T00385                                 

Gene name
yhjA
Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
chu  Cytophaga hutchinsonii
Brite
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CHU_2275 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2648215..2649312)
Genome map
AA seq 365 aa AA seqDB search
MSEHIAFLSPAYFFVSSQTLYEDMNLSIRVFLILTSVLFCCSAVYNITEKPYVLNIPEGF
PQPYIPEDNALTYARIELGKKLFYDTLLSSDRSVSCSSCHLQTMGFTDGKTLSTGVNQRV
SDRNGMPLINLAWSNAFFWDGGVPSLELQVLKPLTSPNEMNLPVQEAVNRLNADHVYKKL
FKKAYGTNPDAASLFKAIASFERTLISADTKFDAYFYKKDPAAFNESELRGYKLFFGGDK
VHCGSCHSGINLTNNSFQNNGLYMEYSDQGRYRITGKESDKGKFKVPTLRNIALTAPYMH
DGSLKTLEEVIDHYNTGGISHPNKSEHVHIHKGMKLNTQDKKDLVSFLHTLTDMTFITNK
AFRPE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacatattgcttttttatcacctgcgtactttttcgtatcttcacaaactctt
tatgaagacatgaacctttctatccgcgttttcttaatccttacgagtgtgctgttttgc
tgctctgcagtatataacataacagaaaagccgtatgtattaaacatcccggaaggattc
ccgcagccttatattccggaagataatgcgctcacctatgcccggatcgaattaggtaaa
aagttgttctatgacacccttttatcttcagaccgttctgtttcgtgttcctcctgtcac
ctgcaaacaatggggtttaccgatggtaaaacgttaagcacaggggtgaatcaacgggta
agcgaccgcaacggaatgcctttgatcaaccttgcctggtccaatgcctttttctgggac
ggcggtgtaccgagcctggaactgcaggtgttgaaacccctcaccagtccgaatgaaatg
aatctgccggtgcaggaagccgtaaaccggctgaatgcagatcatgtatacaaaaagctt
ttcaaaaaagcctatggaacgaatccggatgctgccagtttgttcaaggcaattgcttca
tttgaacgtacgctcataagtgcagatacaaagttcgatgcgtacttttataaaaaagat
ccggctgcttttaatgaatctgaactgcgcgggtataaattattttttggtggtgataag
gttcactgtggttcctgccattcaggaattaacctgaccaacaacagttttcagaataac
ggtttgtatatggaatacagtgatcagggcagataccggatcaccggaaaagaaagtgat
aaagggaaatttaaagtgccaacacttcgcaacattgctttaacagcgccttacatgcac
gatggcagcctgaagacactcgaagaagtgattgatcattataatacagggggaatttct
catccaaataaatcagaacatgtgcatattcataaaggcatgaagttaaacacgcaggat
aaaaaagacctggtcagttttctgcatacgcttacagatatgacgtttattaccaataaa
gcttttcgtccggaataa

DBGET integrated database retrieval system