KEGG   Cytophaga hutchinsonii: CHU_2413Help
Entry
CHU_2413          CDS       T00385                                 

Definition
cinnamyl-alcohol dehydrogenase (EC:5.1.3.2)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
chu  Cytophaga hutchinsonii
Brite
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     CHU_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2775025..2776083
Genome map
AA seq 352 aa AA seqDB search
MTHINKEKPVLVTGATGYVAGWIVKKLLDEGFTVHASVRNPTDNDKLKYLNTLAQQASGT
IKYFKADLLEAGSYDEAMEGCELVFHTASPFINKVADPQRDLVDPALIGTKNVLASVNKT
ASVKRVVLTSSVAAIIGDAIDCSKMPDGAGTEAHWNTTSTLNHQPYNYSKTVAERAAWEI
NKKQNRWDLVVINPSLVIGPGLNPFATSESFNIVRQVGDGSMRFGIPDFTIGVVDVRDLA
EAHVIAGLKPDAEGRNIISAQNTGLLELAGMLRKKFGTAYHFPTRLLPKSLVWLLAPLAG
FKRDMINRNVGYPWRVDNTKSIQKLGIHYRPIEESIVELFQQMIDNGIVKKK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacacacatcaataaagaaaaacctgttctggtaacaggtgctacaggatatgtagct
ggctggattgtaaaaaaattactggatgaaggttttaccgtgcatgcatctgtacgaaat
ccaaccgataacgacaaactgaaatatttaaatacccttgcccagcaggcttccggaacg
attaaatattttaaagctgatctgttagaggcaggctcgtatgatgaagctatggaaggt
tgtgaattggtatttcataccgcttctccgttcattaataaagtagcagacccgcaacgt
gatttagtagatccggcattgatcggaaccaaaaacgtattggcttcagtaaataaaact
gcgtctgtaaaacgtgtggtgttaaccagcagtgtagccgctattattggtgatgccatt
gactgcagcaaaatgcctgacggggctggcacggaagcacattggaacacgacttctacg
ttaaatcaccagccgtataattattctaaaacagtggcagaacgggctgcctgggaaata
aataaaaaacagaatcgctgggatcttgttgtgataaatccttcactggttatcggacca
ggtttaaatccatttgctacttctgaaagctttaatattgtgcgccaggtcggcgatggc
agcatgcgttttggcataccggattttaccatcggtgtagtggatgtacgtgatctggcc
gaagcccatgttattgccggcttaaagcctgacgccgaaggacggaatattatctcggca
caaaatacaggcttacttgaactggcaggtatgctgcgtaaaaagtttggtactgcttac
cacttccctaccaggctattgcctaaatcattggtatggctgctggcgccgcttgccggc
tttaaacgcgacatgattaaccgaaacgttggttatccgtggcgcgtagataatacaaag
agtattcagaagttaggaatacattacaggccgattgaagaatcaatcgttgaattgttt
cagcagatgattgataacggaattgtgaagaaaaaataa

DBGET integrated database retrieval system