KEGG   Cytophaga hutchinsonii: CHU_2468Help
Entry
CHU_2468          CDS       T00385                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
chu  Cytophaga hutchinsonii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2837103..2837609
Genome map
AA seq 168 aa AA seqDB search
MKNQQLHSAVLLLGSNLGERKNFLEQAAGKIAQQIGSITKISSYYETKSWGLEDQPDFLN
QVLVCQTACTAEKTLALCLSIEKELGRNRKEKWGSRTIDIDILYFNRDIIASGILKVPHP
FLQQRRFVLVPLCEVMPDFIHPIYNFSNQQLLERCTDMLEVIKLNAKS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcagcaattacatagcgctgtacttttgcttggcagcaacctgggtgaacgt
aagaattttctggagcaggctgccggtaaaattgctcagcagatcggttctattacaaaa
atatcttcatactatgaaaccaaatcctggggacttgaagatcagccggattttttaaat
caggtattggtttgtcaaacggcatgtacagcagagaaaacattagcgttgtgtctatcg
atcgaaaaagaactgggcagaaacagaaaagaaaaatggggcagccgcacaattgatatt
gatatcttatattttaaccgggatattattgcttccggaatactaaaagtaccgcatccc
ttcctgcaacaacgcaggtttgtgttagtgcctctttgtgaagtgatgccggatttcata
catccgatatacaatttttcaaatcagcagctgctggagcggtgtacggatatgttggaa
gtgataaagcttaatgccaaaagctaa

DBGET integrated database retrieval system