KEGG   Cytophaga hutchinsonii: CHU_2493Help
Entry
CHU_2493          CDS       T00385                                 

Gene name
dsb
Definition
dithiol-disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
chu  Cytophaga hutchinsonii
Brite
Enzymes [BR:chu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CHU_2493 (dsb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2864471..2865199
Genome map
AA seq 242 aa AA seqDB search
MEATNKMKVEVWSDIMCPFCYIGKRNYEAGLKQFADSNNIEIIWKSFQLDPNIPQDTAVT
ENVYQYLAERKGMSYEQSVQMHDSVVATAKKAGLDYNFDKAVIANSFNAHRMIQLAKTKD
LGDAAEERLFYAYFTEGKNVGNSYVLIELGKDIGLTEAEVQTALTDDTYAYKVRQDVEEA
QHLGVRGVPFFVFDRKYAVSGAQPPQAFLETLEKSFSEWRKEHPASPFEVSEGPSCSVDG
CD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaacaaataaaatgaaggtagaagtatggagcgacattatgtgtcccttctgc
tacatcggaaaaagaaattacgaagctggtttaaagcaatttgcagacagcaataacata
gaaatcatctggaaaagttttcagcttgacccgaacattcctcaggatacagctgtaaca
gaaaatgtatatcaatatcttgcagagcgcaaaggcatgagctatgaacaatcggtacag
atgcacgacagtgtagttgcaaccgcaaaaaaggccgggctggattacaattttgataaa
gctgttattgcaaattcattcaacgcacaccgcatgattcagctggcaaaaaccaaagac
ttgggtgatgctgcagaagaacgtttattttatgcttatttcacggaaggcaaaaacgtt
ggcaactcctatgtattgattgaattaggtaaagacattgggttaaccgaagcagaagtt
caaacagctctaacggatgatacgtatgcctacaaagtaagacaggatgttgaggaagca
cagcacttaggcgtacgcggtgttccattctttgtattcgaccgtaagtatgctgtttca
ggtgcacagcctccgcaggcttttctggaaacgctggaaaaatcgttttcagaatggcgc
aaagaacatccggcttctccatttgaagtatccgaaggaccatcgtgttctgttgatggc
tgcgactaa

DBGET integrated database retrieval system