KEGG   Cytophaga hutchinsonii: CHU_2527Help
Entry
CHU_2527          CDS       T00385                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chu  Cytophaga hutchinsonii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHU_2527 (pdhC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHU_2527 (pdhC)
  Amino acid metabolism
   00310 Lysine degradation
    CHU_2527 (pdhC)
Enzymes [BR:chu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CHU_2527 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2906162..2907544
Genome map
AA seq 460 aa AA seqDB search
MALVELVMPKMGESVMEGTILNWLKKPGDRIQQDESVLEVATDKVDTEVPSPFNGILKEI
KANQGDVVQVGTAIALIETDVNQAANSEPATTAPAANTNSGTATTQTVQQTAVAEKIPVS
TPQTHIPAHTAGAKGGRFYSPLVLNIARQENISLAEVETIAGTGKDGRVTKNDLFDYLQA
KKEGKVTAVTQETVVNETPQATEQKAPVAEPVYVNKPASSQSGNVEIIQMDRMRKMIADR
MVESKRISPHVTSFVEADVTNIVYWRNRWKNDFMERENVALTFTPIFIEAVVKAIKDYPM
VNISIEDDKIIVKKDINIGIAVALPNGNLIVPVIKNADQLNIVGLTKKVNDLAKRARQNK
LTADDLSGGTYTVSNVGSFGNLMGTPIIVQPQAAILALGAVVKKPAVIETPQGDTLGIRH
MMFLSHSYDHRAIDGSLGGMFVRRVADFLENFDVNRKIFV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggccttggttgaattggtaatgcccaaaatgggagaaagcgtaatggaaggaacgatt
ttaaactggttgaaaaaaccgggagatcgtatccaacaagatgaatctgttttggaagta
gctacagacaaagtagacacagaagtgccttctccatttaacggaattttaaaagaaata
aaagcgaatcagggtgatgttgttcaggtaggaacagcgatagctcttattgaaaccgac
gtcaatcaggcggcaaatagtgagcctgcaaccactgctcctgcggcaaatacaaattct
ggtacggcaactacacaaacagtacaacagacagctgtggctgaaaaaatacctgtctcc
actcctcagactcatatccccgctcatacagctggtgccaaaggcggaagattctattcg
ccattggttttaaatattgctcgccaggaaaatatatctttggcggaagttgaaaccatt
gccggtacaggcaaagacggacgtgttacaaaaaatgatctgttcgattacctgcaggct
aaaaaagaaggtaaggtaacggctgttactcaggaaactgttgttaacgaaacaccacag
gcaacggaacaaaaagcaccagttgctgaacctgtttatgtgaacaaacctgcttcttct
caaagcggtaatgtagaaatcatacaaatggatcgcatgcgtaagatgattgcagaccgc
atggttgaatcaaaacgcatttctccgcacgttacatcttttgttgaagcagatgtaacc
aatattgtatactggagaaaccgctggaaaaatgatttcatggaacgtgaaaatgttgcc
ttaacatttacacctattttcattgaagccgttgttaaagcaataaaagattacccgatg
gttaacatctctattgaagacgataaaatcattgtaaaaaaagatatcaatatcggtata
gcggttgcacttccgaatggtaatttaattgttcctgtaattaaaaatgcagatcagtta
aacattgtaggacttactaaaaaagtaaatgacctggcaaagcgtgcccgtcagaataaa
cttacagcggatgatctttccggaggaacctataccgtttcaaatgtcggctctttcggt
aatttaatgggaacgcctatcattgttcagcctcaggcagccattcttgcgttgggtgct
gtggttaaaaaacctgctgttattgaaacaccacaaggcgatacacttggtatccgccat
atgatgttcttatcacactcttacgatcatcgcgcaattgatggttcactaggcggtatg
tttgttcgcagagtggctgatttcttagaaaactttgatgtaaacagaaaaatatttgtc
taa

DBGET integrated database retrieval system