KEGG   Cytophaga hutchinsonii: CHU_2527Help
Entry
CHU_2527          CDS       T00385                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chu  Cytophaga hutchinsonii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHU_2527 (pdhC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHU_2527 (pdhC)
  Amino acid metabolism
   00310 Lysine degradation
    CHU_2527 (pdhC)
Enzymes [BR:chu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CHU_2527 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2906162..2907544
Genome map
AA seq 460 aa AA seqDB search
MALVELVMPKMGESVMEGTILNWLKKPGDRIQQDESVLEVATDKVDTEVPSPFNGILKEI
KANQGDVVQVGTAIALIETDVNQAANSEPATTAPAANTNSGTATTQTVQQTAVAEKIPVS
TPQTHIPAHTAGAKGGRFYSPLVLNIARQENISLAEVETIAGTGKDGRVTKNDLFDYLQA
KKEGKVTAVTQETVVNETPQATEQKAPVAEPVYVNKPASSQSGNVEIIQMDRMRKMIADR
MVESKRISPHVTSFVEADVTNIVYWRNRWKNDFMERENVALTFTPIFIEAVVKAIKDYPM
VNISIEDDKIIVKKDINIGIAVALPNGNLIVPVIKNADQLNIVGLTKKVNDLAKRARQNK
LTADDLSGGTYTVSNVGSFGNLMGTPIIVQPQAAILALGAVVKKPAVIETPQGDTLGIRH
MMFLSHSYDHRAIDGSLGGMFVRRVADFLENFDVNRKIFV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggccttggttgaattggtaatgcccaaaatgggagaaagcgtaatggaaggaacgatt
ttaaactggttgaaaaaaccgggagatcgtatccaacaagatgaatctgttttggaagta
gctacagacaaagtagacacagaagtgccttctccatttaacggaattttaaaagaaata
aaagcgaatcagggtgatgttgttcaggtaggaacagcgatagctcttattgaaaccgac
gtcaatcaggcggcaaatagtgagcctgcaaccactgctcctgcggcaaatacaaattct
ggtacggcaactacacaaacagtacaacagacagctgtggctgaaaaaatacctgtctcc
actcctcagactcatatccccgctcatacagctggtgccaaaggcggaagattctattcg
ccattggttttaaatattgctcgccaggaaaatatatctttggcggaagttgaaaccatt
gccggtacaggcaaagacggacgtgttacaaaaaatgatctgttcgattacctgcaggct
aaaaaagaaggtaaggtaacggctgttactcaggaaactgttgttaacgaaacaccacag
gcaacggaacaaaaagcaccagttgctgaacctgtttatgtgaacaaacctgcttcttct
caaagcggtaatgtagaaatcatacaaatggatcgcatgcgtaagatgattgcagaccgc
atggttgaatcaaaacgcatttctccgcacgttacatcttttgttgaagcagatgtaacc
aatattgtatactggagaaaccgctggaaaaatgatttcatggaacgtgaaaatgttgcc
ttaacatttacacctattttcattgaagccgttgttaaagcaataaaagattacccgatg
gttaacatctctattgaagacgataaaatcattgtaaaaaaagatatcaatatcggtata
gcggttgcacttccgaatggtaatttaattgttcctgtaattaaaaatgcagatcagtta
aacattgtaggacttactaaaaaagtaaatgacctggcaaagcgtgcccgtcagaataaa
cttacagcggatgatctttccggaggaacctataccgtttcaaatgtcggctctttcggt
aatttaatgggaacgcctatcattgttcagcctcaggcagccattcttgcgttgggtgct
gtggttaaaaaacctgctgttattgaaacaccacaaggcgatacacttggtatccgccat
atgatgttcttatcacactcttacgatcatcgcgcaattgatggttcactaggcggtatg
tttgttcgcagagtggctgatttcttagaaaactttgatgtaaacagaaaaatatttgtc
taa

DBGET integrated database retrieval system