KEGG   Cytophaga hutchinsonii: CHU_2527Help
Entry
CHU_2527          CDS       T00385                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chu  Cytophaga hutchinsonii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:chu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:chu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:chu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2906162..2907544
Genome map
AA seq 460 aa AA seqDB search
MALVELVMPKMGESVMEGTILNWLKKPGDRIQQDESVLEVATDKVDTEVPSPFNGILKEI
KANQGDVVQVGTAIALIETDVNQAANSEPATTAPAANTNSGTATTQTVQQTAVAEKIPVS
TPQTHIPAHTAGAKGGRFYSPLVLNIARQENISLAEVETIAGTGKDGRVTKNDLFDYLQA
KKEGKVTAVTQETVVNETPQATEQKAPVAEPVYVNKPASSQSGNVEIIQMDRMRKMIADR
MVESKRISPHVTSFVEADVTNIVYWRNRWKNDFMERENVALTFTPIFIEAVVKAIKDYPM
VNISIEDDKIIVKKDINIGIAVALPNGNLIVPVIKNADQLNIVGLTKKVNDLAKRARQNK
LTADDLSGGTYTVSNVGSFGNLMGTPIIVQPQAAILALGAVVKKPAVIETPQGDTLGIRH
MMFLSHSYDHRAIDGSLGGMFVRRVADFLENFDVNRKIFV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggccttggttgaattggtaatgcccaaaatgggagaaagcgtaatggaaggaacgatt
ttaaactggttgaaaaaaccgggagatcgtatccaacaagatgaatctgttttggaagta
gctacagacaaagtagacacagaagtgccttctccatttaacggaattttaaaagaaata
aaagcgaatcagggtgatgttgttcaggtaggaacagcgatagctcttattgaaaccgac
gtcaatcaggcggcaaatagtgagcctgcaaccactgctcctgcggcaaatacaaattct
ggtacggcaactacacaaacagtacaacagacagctgtggctgaaaaaatacctgtctcc
actcctcagactcatatccccgctcatacagctggtgccaaaggcggaagattctattcg
ccattggttttaaatattgctcgccaggaaaatatatctttggcggaagttgaaaccatt
gccggtacaggcaaagacggacgtgttacaaaaaatgatctgttcgattacctgcaggct
aaaaaagaaggtaaggtaacggctgttactcaggaaactgttgttaacgaaacaccacag
gcaacggaacaaaaagcaccagttgctgaacctgtttatgtgaacaaacctgcttcttct
caaagcggtaatgtagaaatcatacaaatggatcgcatgcgtaagatgattgcagaccgc
atggttgaatcaaaacgcatttctccgcacgttacatcttttgttgaagcagatgtaacc
aatattgtatactggagaaaccgctggaaaaatgatttcatggaacgtgaaaatgttgcc
ttaacatttacacctattttcattgaagccgttgttaaagcaataaaagattacccgatg
gttaacatctctattgaagacgataaaatcattgtaaaaaaagatatcaatatcggtata
gcggttgcacttccgaatggtaatttaattgttcctgtaattaaaaatgcagatcagtta
aacattgtaggacttactaaaaaagtaaatgacctggcaaagcgtgcccgtcagaataaa
cttacagcggatgatctttccggaggaacctataccgtttcaaatgtcggctctttcggt
aatttaatgggaacgcctatcattgttcagcctcaggcagccattcttgcgttgggtgct
gtggttaaaaaacctgctgttattgaaacaccacaaggcgatacacttggtatccgccat
atgatgttcttatcacactcttacgatcatcgcgcaattgatggttcactaggcggtatg
tttgttcgcagagtggctgatttcttagaaaactttgatgtaaacagaaaaatatttgtc
taa

DBGET integrated database retrieval system