KEGG   Cytophaga hutchinsonii: CHU_2773Help
Entry
CHU_2773          CDS       T00385                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHU_2773 (pfkA)
   01230 Biosynthesis of amino acids
    CHU_2773 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHU_2773 (pfkA)
   00030 Pentose phosphate pathway
    CHU_2773 (pfkA)
   00051 Fructose and mannose metabolism
    CHU_2773 (pfkA)
   00052 Galactose metabolism
    CHU_2773 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CHU_2773 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CHU_2773 (pfkA)
Enzymes [BR:chu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHU_2773 (pfkA)
Protein phosphatases and associated proteins [BR:chu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHU_2773 (pfkA)
Messenger RNA biogenesis [BR:chu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CHU_2773 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3157905..3158891
Genome map
AA seq 328 aa AA seqDB search
MKKIAVYTSGGDAPGMNACIRAAVRAGHYHNLEVYGIVRGYDGMINGNFIELDNRAVSNI
IQKGGTILKSARSEEFRSPEGRRKAFDQIQKFGIDGLVAIGGNGTFTGAELFYNEYQIPC
VGAPGTIDNDLYGSDFTIGYDTAVNTCLAAIDKIRDTADAHERVFFIEVMGRDTGYIAVR
SAISGGAEMAIIPEFPYDKNVVINRLKHGTSDTKASHIIIVAEGHQEGRASMIARDIKEA
LPQLDCRVTTLGHVQRGGGPSAADRVLASRLGLATVEGLLEGRANVMAGIIDHKVVYTPF
IDTITKRKPINEDLLSLAEKLNGRSYKV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagcagtatatacatctgggggcgatgcgccaggaatgaatgcatgtatt
cgcgcggcggttcgtgcgggtcattaccataatcttgaagtttatggtattgttcgtgga
tatgacgggatgattaatgggaattttatcgaacttgacaatcgtgctgttagtaacatt
attcaaaaaggcggaacgattctaaaatctgcgcgcagcgaagaattcagatctccggag
ggaagacgcaaagcgttcgatcagattcagaaattcggtatcgacggtttggttgccatt
ggcggtaacggaacatttaccggagctgaattattttacaatgaatatcaaatcccttgt
gttggcgcaccgggaacaatagataatgatctgtatggttctgattttaccattgggtat
gatactgccgtaaacacatgtttagcagcaatcgataagatccgtgatacggcagatgca
cacgaacgtgtattctttattgaagtaatgggccgtgatacaggctacatcgctgtacgc
tcggctatttcaggcggagcagaaatggcgattatacccgagtttccgtatgacaaaaat
gttgttatcaaccgtttgaaacatggcacaagtgacactaaagcatctcacattattatt
gttgctgaaggtcaccaggaaggtcgtgcaagtatgattgcaagagatattaaagaagcg
ctacctcaattagattgcagagtaaccacattaggacacgtgcaacgtggaggcgggcca
tcagcggctgatcgcgtattagccagccgtctgggtctggctacggtggaaggcttactt
gaaggaagagcaaatgtaatggctggcattatcgatcataaagtagtttatactcctttt
attgatacaattaccaagagaaagccgatcaatgaagatttactttcattggcagaaaaa
ttaaatggcagaagctataaagtatag

DBGET integrated database retrieval system