KEGG   Cytophaga hutchinsonii: CHU_3118Help
Entry
CHU_3118          CDS       T00385                                 

Gene name
yhjA
Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
chu  Cytophaga hutchinsonii
Brite
Enzymes [BR:chu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CHU_3118 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3560824..3562812)
Genome map
AA seq 662 aa AA seqDB search
MRRVACCRATRLFVMKLTKMKKYILLITVLGTLFVSISFISKTESLVSSEYPSLYTERIQ
AFKQKQTALLRRIDESNVTKESDLEQIKEIIQQTRVQLKGVDFWLRYLEPISYKKINGPL
PVEWETEVFEKHEAPYKREAAGLTLAYLYLEESGIEKKELKRLVQESISATDVYFADSIT
KHLADYHHFYLCNRLYLLNISAIYTTGFECPDTEQVIPELLSMMKDMQPVYVAYNKSFPA
TAIYPEYLELYEKAIDFVFKQPNDLNDFDHFTFIQQYINPLFALNQKMIHKYNVSSKNLV
DYSLNKNSTSIFDKGLYYAQNTKGIFSRVTDSTDLNELNDLGKLLFYDPILSGNNLRSCA
SCHLPTEYFTDTLNRTALQFNRVDRLPRNTPSLINVQQNHLLMMDGAHITMQNQAKSVIL
NPTEMGSTEIALIQKVLSCKEYNTRFTKLLKYTPQEKGITIDHITSALTIYYSKFSNGYS
DFDASMIEKKSIDPIVQEGFNLFMSKAQCATCHFVPQFNGVKPPYVNSEFEVIGVPADKL
FSRVSMDNGRTVVYVSDEMNRAFRTGSIRNAPYTKPYMHNGVFDNLTEVIEFYNNGGGAG
RGLDIPNQTLSSDSLHLTKEEINKIEVFIQSLNEHIVFEKPPLTLPVSKDKVLNQRKVGG
EY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
ttgagacgggttgcgtgttgtcgcgcaacccgtttatttgttatgaagcttactaaaatg
aaaaagtatatattattaataacagtattaggtacattatttgtatcaatttcatttata
tccaaaacagaatctcttgtatcatctgaatatccgtctttatacacagaacgtatacag
gcattcaaacaaaagcaaaccgcgttattacgaaggattgatgaaagtaatgtaacgaag
gaatcggatcttgaacagataaaagaaattattcagcaaacgcgtgttcagttaaaaggc
gttgatttttggctgcgttatctggaaccaatttcatataaaaaaattaacgggccgctt
ccggtagaatgggagacagaagtatttgaaaaacatgaagcgccttataagcgagaggcc
gcggggttaacgctggcatatctgtatctggaagaatccggtatagaaaaaaaagaatta
aagcgattggttcaggaatctatttctgcaacggatgtttactttgcagattccataaca
aagcaccttgcagattatcaccatttttatttatgtaacagattgtatctgttaaatatt
tccgccatttatactacaggctttgagtgtccggatacggaacaggtaattcccgaattg
ttgagtatgatgaaagatatgcagccagtgtatgtcgcatacaataaaagctttccagct
acagccatttatccagaatatttagaactgtatgaaaaagccattgattttgttttcaaa
caaccaaacgatttaaacgattttgatcattttacattcattcagcaatacataaatccg
ctgtttgcattgaatcaaaaaatgattcataaatataacgtgtccagtaaaaacctggtt
gattattcgttaaataaaaacagcacatctatttttgataaaggattgtattatgcacag
aatacaaaagggattttttcccgggtaacagattctacagatcttaacgagttaaatgat
ttaggtaaattgttgttttacgatccgatcttatccggaaataatttacgcagctgtgct
tcgtgccatttgcctaccgaatattttacagatacgcttaaccgtacagcacttcagttt
aaccgggttgatcgcttaccaagaaatacaccttcattgattaatgtacagcaaaatcat
ttgctgatgatggatggcgcgcacattaccatgcagaaccaggcaaaaagtgttatactc
aacccgactgaaatgggaagtacagaaatagcgctcatacaaaaagtgctgagctgtaaa
gaatacaatacacgttttacaaaattactaaagtatacaccacaggaaaaaggcatcacc
attgatcacatcacatctgcattaaccatttattacagcaagttcagtaacggttattcg
gattttgatgcatctatgattgaaaaaaaatctatagatcctattgtgcaggaaggtttt
aatctgttcatgagtaaagcgcaatgtgcaacatgtcattttgtgccacaatttaatgga
gtaaaaccaccgtatgtgaattcagaatttgaagtgatcggcgtgcctgcagataaatta
ttttcacgtgtaagtatggataatggtcgaacagttgtttatgtttccgatgaaatgaac
cgtgcgttcagaacagggtctatacgcaacgctccgtatacaaagccttatatgcataat
ggcgtttttgataatctaacagaagtaattgaattttacaacaatggcggcggtgcagga
agaggacttgacataccgaatcaaacactttcttcggattcgttgcacttaacaaaggaa
gaaataaataagattgaagtctttattcaatccttaaatgaacatattgtttttgaaaaa
cctccgttaacattacctgtatcaaaggataaggtgttgaatcagcgaaaagtgggcggc
gaatattaa

DBGET integrated database retrieval system