KEGG   Cytophaga hutchinsonii: CHU_3277Help
Entry
CHU_3277          CDS       T00385                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHU_3277 (tpiA)
   01230 Biosynthesis of amino acids
    CHU_3277 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHU_3277 (tpiA)
   00051 Fructose and mannose metabolism
    CHU_3277 (tpiA)
   00562 Inositol phosphate metabolism
    CHU_3277 (tpiA)
Enzymes [BR:chu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CHU_3277 (tpiA)
Exosome [BR:chu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CHU_3277 (tpiA)
  Exosomal proteins of bladder cancer cells
   CHU_3277 (tpiA)
  Exosomal proteins of melanoma cells
   CHU_3277 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3748584..3749339)
Genome map
AA seq 251 aa AA seqDB search
MRKKVIAGNWKMNKTLEEGLSLASEVANMAKDEVPADVNLVMCIPYISLAAVSKVINDKV
AIGAQNVYQKESGAFTGEISAPMLKSVGVKYVIIGHSERREYFGETNQQLADKVTISLAN
GLTPLFCCGETLAQREAGIHINFVNAQLTESLFHLSPEDFKKVVIAYEPIWAIGTGVTAS
DEQAQEMHAKIREHLASKYGAAVADEISILYGGSMKPDNAKGLLACKDIDGGLIGGASLK
SRDFIDIAKSY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaagtaattgcaggaaattggaaaatgaacaaaacacttgaagaaggcttg
tcattagcttctgaagtggcaaatatggcaaaggatgaagttcctgcagatgtaaatctt
gtaatgtgtattccttatatctcattggctgctgtttcaaaagtaatcaacgataaagta
gctatcggcgcgcaaaacgtatatcaaaaagaatccggtgcatttacaggtgagatttca
gctccgatgttgaagtctgtaggtgtaaagtatgtaatcatcggacacagcgaaagaaga
gaatattttggtgaaacaaatcagcaattggctgataaagtaactatttccctggcaaat
ggtttaacgccattattctgctgcggagaaacacttgcacaaagagaagcaggtatccac
atcaattttgtaaatgctcagttaacagaaagcttattccatttatcaccggaagatttc
aaaaaagtagttattgcatacgaaccaatctgggcaatcggaacaggcgttacagcttct
gacgagcaggcacaggaaatgcacgcgaagatccgtgagcacctggcatctaaatatggt
gctgcagtagcagatgagatcagcattttatatggtggcagcatgaaaccggacaatgca
aaaggcctgttggcttgcaaagatattgacggggggttgatcggcggtgcatcgttaaag
tcacgtgactttattgatatcgctaagtcatactaa

DBGET integrated database retrieval system