KEGG   Cytophaga hutchinsonii: CHU_3293Help
Entry
CHU_3293          CDS       T00385                                 

Gene name
trpC
Definition
indole-3-glycerolphosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
chu  Cytophaga hutchinsonii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:chu01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:chu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3765734..3766519
Genome map
AA seq 261 aa AA seqDB search
MNILDKIIEHKWTEIADRKAAVPVEELRRSSLYNRPTLSFKKYLSNPALSGVIAEHKRQS
PSKGVINANVDLKQVVTGYQAAGASACSVLTDTKFFGGTTEDLLQARALIQIPILRKDFM
VDEYQIEEARAMGADVILLISACLTPQRIKELSEYAHKLDLEVLLEVHNAEELEGNLIDT
VDVIGVNNRNLKTFDVSIQTSIDVAKHIPERYIKVSESGIDDPKTIIELKKHGYTGFLIG
ESFMKTNDPGAALKKLVAESK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcctggataaaataattgaacataagtggacagaaatagctgacagaaaagca
gcggttcccgttgaagaacttcgcaggtcttctttatataaccgacctaccctttcgttc
aaaaaatatttaagtaatccggcattgagcggtgttattgctgaacataaacggcaatca
ccttcaaaaggcgtaatcaatgcgaacgttgatctgaaacaagttgttacaggttatcag
gctgcaggtgcaagcgcttgttcggttttaacagatacaaaattctttggcggaacaacc
gaagatttattacaggcacgtgcactgatacagattcctattttacgcaaagacttcatg
gtagatgaataccagattgaagaagcgcgtgccatgggagcggatgttattctattaatc
tctgcctgcttaacaccgcagcggattaaagaattgtcggaatatgcacacaaacttgac
ttagaagtgttgcttgaagtacacaatgcggaagagcttgaaggaaatttaattgacacg
gttgatgttattggtgtaaataaccggaacttaaagacatttgacgtaagcattcagaca
tccattgatgtggccaaacacattccggagcgttacatcaaagtttccgaaagcggtatc
gacgatccgaaaacaattattgaattgaaaaaacacggctacacgggctttctgattggt
gaatcatttatgaaaaccaatgatcccggagcggcgctgaaaaaattagtagcggagtcc
aagtaa

DBGET integrated database retrieval system