KEGG   Cytophaga hutchinsonii: CHU_3293Help
Entry
CHU_3293          CDS       T00385                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerolphosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01130  Biosynthesis of antibiotics
chu01230  Biosynthesis of amino acids
Module
chu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHU_3293 (trpC)
Enzymes [BR:chu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CHU_3293 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABG60532
UniProt: Q11PY1
Position
3765734..3766519
Genome map
AA seq 261 aa AA seqDB search
MNILDKIIEHKWTEIADRKAAVPVEELRRSSLYNRPTLSFKKYLSNPALSGVIAEHKRQS
PSKGVINANVDLKQVVTGYQAAGASACSVLTDTKFFGGTTEDLLQARALIQIPILRKDFM
VDEYQIEEARAMGADVILLISACLTPQRIKELSEYAHKLDLEVLLEVHNAEELEGNLIDT
VDVIGVNNRNLKTFDVSIQTSIDVAKHIPERYIKVSESGIDDPKTIIELKKHGYTGFLIG
ESFMKTNDPGAALKKLVAESK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcctggataaaataattgaacataagtggacagaaatagctgacagaaaagca
gcggttcccgttgaagaacttcgcaggtcttctttatataaccgacctaccctttcgttc
aaaaaatatttaagtaatccggcattgagcggtgttattgctgaacataaacggcaatca
ccttcaaaaggcgtaatcaatgcgaacgttgatctgaaacaagttgttacaggttatcag
gctgcaggtgcaagcgcttgttcggttttaacagatacaaaattctttggcggaacaacc
gaagatttattacaggcacgtgcactgatacagattcctattttacgcaaagacttcatg
gtagatgaataccagattgaagaagcgcgtgccatgggagcggatgttattctattaatc
tctgcctgcttaacaccgcagcggattaaagaattgtcggaatatgcacacaaacttgac
ttagaagtgttgcttgaagtacacaatgcggaagagcttgaaggaaatttaattgacacg
gttgatgttattggtgtaaataaccggaacttaaagacatttgacgtaagcattcagaca
tccattgatgtggccaaacacattccggagcgttacatcaaagtttccgaaagcggtatc
gacgatccgaaaacaattattgaattgaaaaaacacggctacacgggctttctgattggt
gaatcatttatgaaaaccaatgatcccggagcggcgctgaaaaaattagtagcggagtcc
aagtaa

DBGET integrated database retrieval system