KEGG   Cytophaga hutchinsonii: CHU_3296Help
Entry
CHU_3296          CDS       T00385                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHU_3296 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHU_3296 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHU_3296 (trpB)
Enzymes [BR:chu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHU_3296 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3768041..3769237
Genome map
AA seq 398 aa AA seqDB search
MNYNVDKKGYYGNFGGAFIPEMLYPNVEELRENYLKIINDESFQKEYQDLLKNYVGRPTP
LYLAKRLSEKYNATIYLKREDLCHTGAHKINNTIGQILIAKRMGKTRIIAETGAGQHGVA
TATACALMGMPCVVHMGAVDMDRQKPNVERMRMLGAEVIPAMTGSRTLKDATNEALRDWI
NNPVDTFYIIGSVVGPHPYPDMVARLQAVISEEIIDQLQETTGNPDPTHVIACVGGGSNA
AGSFYHFLDRPNVELIAVEAAGEGVYSGYSAATTFLGKPGVLHGSKTLLMQTEDGQVVEP
HSISAGLDYPGIGPMHANLFETGRAKFFSITDKEAFQAAFMLARTEGIIPALESAHAVAA
LENIALKKSDVVVVNLSGRGDKDMMTYITRKEEFLTNN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaactataacgtagataaaaaaggatactatggaaatttcggtggagcgtttattccc
gaaatgctgtatcccaatgttgaagaacttcgtgaaaattatttaaagattatcaacgat
gaatcttttcaaaaggaatatcaagacctccttaaaaattatgtaggcagacctactcct
ttgtatttggcaaaacgcttatctgaaaaatataacgctaccatttatttaaagcgtgaa
gatctgtgtcacacaggtgcacacaagatcaacaatacgatcggccagatcctgatcgca
aagcgtatgggtaaaacccgtattattgctgaaacaggtgccggccagcacggtgttgca
acggctacagcctgtgcattaatgggcatgccgtgtgtggtgcatatgggcgctgttgac
atggacagacaaaaaccaaatgttgagcgcatgcgcatgttaggtgctgaagttatacct
gctatgaccggtagccgcacgctgaaagatgcgacaaacgaagcgttacgcgattggatc
aataacccggttgatacattctatatcattggttctgttgtggggccgcacccatatccg
gatatggttgcccgcttacaggcagtaatcagcgaagagattattgatcagctgcaggaa
acaaccggtaatcctgatcctacacatgtgattgcatgcgttggcggcggcagtaatgca
gccggttcgttttatcatttccttgatcgcccgaatgtagaattgattgctgttgaagct
gcaggtgaaggtgtatattccggttattctgccgcaactacgttcttaggtaaaccaggt
gtgttgcacggcagcaaaaccttgctgatgcagacagaagatggtcaggttgtagaacca
cattctatttctgcaggcctggattatccgggcatcgggcccatgcatgccaacttattt
gaaaccggccgtgcaaaattctttagcataacagataaagaagcgttccaggccgcattc
atgctggctcgtacagaaggcatcattcctgctttggaatcagcgcatgcagtggccgcc
cttgaaaatattgcattgaaaaaatctgatgtggtagttgtcaatttatccggccgcggc
gataaagatatgatgacatacattacaagaaaagaagaattcttaacaaacaactaa

DBGET integrated database retrieval system