KEGG   Cytophaga hutchinsonii: CHU_3297Help
Entry
CHU_3297          CDS       T00385                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
chu  Cytophaga hutchinsonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHU_3297 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHU_3297 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHU_3297 (trpA)
Enzymes [BR:chu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHU_3297 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3769239..3770036
Genome map
AA seq 265 aa AA seqDB search
METTTKVSNRLTALFQNKSNNLLNIYFTAGYPTLHDTVTVLKALEKAGVDMVEIGMPYSD
PVADGPVIQQSSLDAINNGMTIKTLLQQLKDIRKEVTIPILLMGYFNTVMQYGVEKFMKE
ISEIGIDGVILPDLPLDEYIEHYQSICESNNISNVSLITPNTSDERLLVIDNITQGFIYM
VSTNSTTGNDAKKTEDNHDAYFSRIKNMGLKSPRMIGFNIKDHKTFTDACTYANGAIIGS
AFVRLLAQSKHLERDILTFVSEIRK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggagacaacaacaaaggtttcaaacagattaacagcgttgtttcaaaataaaagcaac
aacttactgaacatatattttacagcgggttacccaacgttacacgatacggtaactgtt
ttgaaagccttggagaaagcgggcgttgacatggttgaaataggtatgccttattccgat
ccggttgccgacggaccggtaattcaacaaagcagcctggacgcaattaataatggaatg
accattaaaaccttgctgcagcaattaaaagatattcgtaaagaagttaccattccgatt
ttattaatgggttatttcaatacggttatgcagtacggcgtcgagaaattcatgaaagag
atcagcgaaattggcatagatggtgttattcttcctgacttaccattggatgaatacatt
gagcactatcaatccatttgtgagtcgaataacatttcaaacgtttcattgatcacaccg
aatacttctgacgaacggctgcttgtaattgataacatcacacaaggtttcatttacatg
gtttctacaaacagcactaccggaaacgatgctaaaaaaacagaagataatcacgacgct
tatttcagccgaattaaaaacatggggttaaaaagcccgcgtatgattggcttcaatatc
aaagaccataaaacattcaccgatgcctgcacgtatgcaaatggcgcaattatcggatcg
gcctttgtacgcctgcttgctcaaagcaaacatcttgaacgagatattctaacttttgta
tcagaaattcgaaaataa

DBGET integrated database retrieval system