KEGG   Cytophaga hutchinsonii: CHU_3446Help
Entry
CHU_3446          CDS       T00385                                 

Definition
(GenBank) UDP-galactopyranose mutase
Organism
chu  Cytophaga hutchinsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_8 Amino_oxidase DAO FAD_oxidored FAD_binding_2 Pyr_redox_3 Pyr_redox_2 Thi4 HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABG60680
UniProt: Q11PI3
Position
3960228..3961697
Genome map
AA seq 489 aa AA seqDB search
MYDIAIIGGGISGFATALRLQNKGFKTIVFESHGQLGGCAGFFSEKGFSFDVGATTLVDF
SKGGIGGDFFEELNFSLPEGEYIDYVLWLPDRKVTLYRDAIKWNKERLEKIGTTKNHIEF
WNLIDKTTEVFWRAARKNIRLPIKNLNDIIYAFRVIGAKNIYLLKYQNYTMLDILKKFKL
ENDKALKGLLSVLIEDTVNSTIDKAPFINASLGCSIRGAGLMRATGGMKGFWNYLSKIYL
SKDGVIKKAHKVLSLSKDRSVWTINTSKGSFYAKKIVSSLPIDLTYNIAPIHIKKILNKY
MFHNKEATGGAIVIFLGVPESNLENEILTHHQILLNYDSPLGNGNNMFISISSKDDTLSA
PLGYRSVMISTHCDINEWKNLSEHQYQLKKEEIGKRLLGYAKRVYPNLVDNGIIYKIGSP
LTYQKFTNRVNGSVGGFKQTLENSNFNSIPQNIGEKDLWIVGDNTWPGLGTVAGLIGSKI
VSKHILETF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatatagccattattggaggaggaatatcaggatttgctactgctttaagacta
caaaataaaggttttaaaacaattgtttttgaatcacatgggcaattaggtggatgtgct
ggcttttttagtgaaaaaggtttttcatttgatgtaggggcaactactttagttgatttt
agtaaagggggaattggaggtgatttttttgaagagcttaatttttctttacctgagggg
gaatatattgattatgtgttatggcttccggatcgaaaagtaacattatatagagatgct
attaaatggaataaagaacggttagaaaaaatcggaaccactaaaaatcacatagaattt
tggaatcttattgataaaacaactgaagtcttttggagggctgcaagaaagaatattcgt
ctaccaataaaaaacctgaatgatattatttatgcttttagagtaattggtgcaaaaaat
atttatttattgaaatatcaaaattacacgatgcttgatattttaaaaaaatttaaactt
gaaaatgataaagccttaaagggattactttcagttcttattgaggatacagttaatagt
acaatagataaagcacctttcattaatgcttctttaggttgttcaataagaggtgctgga
ttaatgagagcaacaggaggaatgaaagggttttggaattatctttcaaaaatttactta
agcaaagatggtgtaattaaaaaagcgcataaagttttaagtctatcaaaagatcgttct
gtctggacaattaatacatctaaaggttccttctatgcaaaaaaaatagttagctcctta
ccaattgatttaacatacaacatcgctcctatccatataaaaaaaatattaaataaatat
atgtttcacaataaagaagctacaggaggggcaatcgtcatttttttaggagtgccggaa
tctaatttagaaaatgaaatattaacgcatcatcaaattttactcaattacgattcacca
ttaggaaatggaaataatatgtttatttccatttcctcaaaggatgatactttgtctgcc
cctcttggatatcgttctgtaatgatttctacccattgtgatattaatgaatggaaaaat
ttatctgaacatcagtatcagcttaaaaaagaagaaattggcaaaagattattaggttat
gctaaacgggtctatccaaatttagtagataatggaatcatctataaaataggtagtcca
ctaacttatcagaagtttacaaatagagtgaacggaagtgttggtggttttaaacaaaca
ttagaaaattcgaatttcaactctattcctcaaaatataggagaaaaagatttatggatt
gttggcgataatacctggcccggacttgggacagttgccggacttattggaagtaaaatt
gtatcgaaacatatacttgaaactttttaa

DBGET integrated database retrieval system