KEGG   Cytophaga hutchinsonii: CHU_3446Help
Entry
CHU_3446          CDS       T00385                                 

Definition
phytoene dehydrogenase
Organism
chu  Cytophaga hutchinsonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3960228..3961697
Genome map
AA seq 489 aa AA seqDB search
MYDIAIIGGGISGFATALRLQNKGFKTIVFESHGQLGGCAGFFSEKGFSFDVGATTLVDF
SKGGIGGDFFEELNFSLPEGEYIDYVLWLPDRKVTLYRDAIKWNKERLEKIGTTKNHIEF
WNLIDKTTEVFWRAARKNIRLPIKNLNDIIYAFRVIGAKNIYLLKYQNYTMLDILKKFKL
ENDKALKGLLSVLIEDTVNSTIDKAPFINASLGCSIRGAGLMRATGGMKGFWNYLSKIYL
SKDGVIKKAHKVLSLSKDRSVWTINTSKGSFYAKKIVSSLPIDLTYNIAPIHIKKILNKY
MFHNKEATGGAIVIFLGVPESNLENEILTHHQILLNYDSPLGNGNNMFISISSKDDTLSA
PLGYRSVMISTHCDINEWKNLSEHQYQLKKEEIGKRLLGYAKRVYPNLVDNGIIYKIGSP
LTYQKFTNRVNGSVGGFKQTLENSNFNSIPQNIGEKDLWIVGDNTWPGLGTVAGLIGSKI
VSKHILETF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatatagccattattggaggaggaatatcaggatttgctactgctttaagacta
caaaataaaggttttaaaacaattgtttttgaatcacatgggcaattaggtggatgtgct
ggcttttttagtgaaaaaggtttttcatttgatgtaggggcaactactttagttgatttt
agtaaagggggaattggaggtgatttttttgaagagcttaatttttctttacctgagggg
gaatatattgattatgtgttatggcttccggatcgaaaagtaacattatatagagatgct
attaaatggaataaagaacggttagaaaaaatcggaaccactaaaaatcacatagaattt
tggaatcttattgataaaacaactgaagtcttttggagggctgcaagaaagaatattcgt
ctaccaataaaaaacctgaatgatattatttatgcttttagagtaattggtgcaaaaaat
atttatttattgaaatatcaaaattacacgatgcttgatattttaaaaaaatttaaactt
gaaaatgataaagccttaaagggattactttcagttcttattgaggatacagttaatagt
acaatagataaagcacctttcattaatgcttctttaggttgttcaataagaggtgctgga
ttaatgagagcaacaggaggaatgaaagggttttggaattatctttcaaaaatttactta
agcaaagatggtgtaattaaaaaagcgcataaagttttaagtctatcaaaagatcgttct
gtctggacaattaatacatctaaaggttccttctatgcaaaaaaaatagttagctcctta
ccaattgatttaacatacaacatcgctcctatccatataaaaaaaatattaaataaatat
atgtttcacaataaagaagctacaggaggggcaatcgtcatttttttaggagtgccggaa
tctaatttagaaaatgaaatattaacgcatcatcaaattttactcaattacgattcacca
ttaggaaatggaaataatatgtttatttccatttcctcaaaggatgatactttgtctgcc
cctcttggatatcgttctgtaatgatttctacccattgtgatattaatgaatggaaaaat
ttatctgaacatcagtatcagcttaaaaaagaagaaattggcaaaagattattaggttat
gctaaacgggtctatccaaatttagtagataatggaatcatctataaaataggtagtcca
ctaacttatcagaagtttacaaatagagtgaacggaagtgttggtggttttaaacaaaca
ttagaaaattcgaatttcaactctattcctcaaaatataggagaaaaagatttatggatt
gttggcgataatacctggcccggacttgggacagttgccggacttattggaagtaaaatt
gtatcgaaacatatacttgaaactttttaa

DBGET integrated database retrieval system