KEGG   Cytophaga hutchinsonii: CHU_3607Help
Entry
CHU_3607          CDS       T00385                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
chu  Cytophaga hutchinsonii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:chu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4161899..4163746)
Genome map
AA seq 615 aa AA seqDB search
MCGITGFISIKWGSDELHSMTRRLQHRGPDAEGFYINESVHLGHRRLSILDLSVAANQPF
FSKDKRYVMVFNGEVFNYKELAVKYAIPTDTTSDTEVILELFALQGPAAFQEFNGMFAIA
IWDTYEKKLTLLRDRFGIKPVCYYDGPDGFGFASEIKSLLELPIPRLINSEALADYLFLE
YIPKPNTIFQNIKKLTNGCYLEVTDGVRVAVKAFYDIREKYDPKPLKEKEGLEEFHHLLS
DAVKSRMISDVPIGAFLSGGVDSSLVVSKFQENSTLPVETFTIGFDEKQYDESAYAKKVS
ELLKTNHHEYRLPAEDVFSVLKDAIEFYDEPFAVSSVLPSLLISKVSRQHTTVALTGDGA
DELFMGYNTYYWYNRIETLKRIGGKASLKLAGNIFKMFGGKPAIKSRLFEGWADKHPYIN
LWSQEQQMFTQQEIGKLLNYRYTHETTIPYWESLEKISLNNEQAVSFFDIQHYLADDLMY
KMDIASMRHGLEVRCPFLDYNLVEFAVNLPLELKINNGTQKYILKKALEKYIPQSLIYRT
KWGFSAPSEEWLKRSHTYLIDHYLDPARISAQGIFNAQEIQKLIASFRSGHYYHGKRLWS
LVIFQLWYEQYMVAK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattactggttttatttctattaaatggggttcggatgaacttcacagcatg
actcgcaggcttcagcaccggggaccggatgcggaaggtttttatataaatgaatctgtt
cacttaggccaccgccgtttaagtatactggatctgtctgttgcggctaatcagccgttc
ttctctaaagacaaacgctatgtgatggtcttcaacggagaagtattcaattacaaagaa
cttgccgttaaatatgctattccaacagatacaacgagtgatacggaagttattctcgaa
ctgtttgccttgcaaggccctgcagcctttcaggaattcaacgggatgtttgccattgca
atatgggatacatatgaaaaaaaattaacgctgttacgtgatcgcttcggaattaaaccg
gtttgttattacgacggaccagacggctttggttttgcatctgaaataaaatcgctgctt
gaattaccgattccgcgactgatcaacagcgaagcgcttgctgattatttattccttgaa
tacattcccaaaccaaataccatttttcaaaacattaaaaagctaacgaatggctgttac
ctggaagttactgatggtgtacgtgtcgcggtaaaagctttttacgacattcgtgaaaaa
tacgatccgaaaccgttaaaagaaaaagaaggcctggaggaatttcatcacctcctttca
gatgcggtgaaatcccgtatgatcagtgatgtgcctattggtgcgtttttgagcggtggc
gttgactcttcgctggtggtttccaaatttcaggaaaacagtacgctgcctgtcgaaaca
tttaccattggttttgatgagaaacaatatgatgaaagtgcttacgcaaaaaaggtttct
gaactattaaaaacaaatcaccacgaataccggctgccggcagaagatgttttttctgtt
ctgaaagatgccatagaattttatgatgaaccctttgcggtttcttctgtattgccaagc
ctgctgatctcaaaggtaagccgccagcatacaactgttgcattgaccggcgatggtgcc
gatgaattattcatgggttataatacctattactggtataaccgcattgaaaccttaaaa
cggattggcggtaaagcatctctcaaacttgccggaaacatatttaaaatgtttggagga
aaacctgcaatcaaatcccgtttgtttgaaggctgggcagataaacatccttatataaat
ctttggtcgcaggaacagcaaatgtttacccagcaagagatcggaaaattattgaattac
agatatacgcatgaaacaaccattccttattgggaatctctggaaaaaatttctctcaat
aacgaacaggctgtttctttttttgacatacagcattacctcgcagatgatctgatgtac
aaaatggacatcgcatctatgcggcatggcttagaagtgcgttgcccgtttcttgattat
aatctcgtggaatttgcggttaatctgccgctggaattaaaaatcaacaacggcacacaa
aaatacattcttaaaaaagcgcttgaaaaatatattcctcaatcgttgatctaccgcacc
aaatggggcttttctgcaccttctgaagagtggcttaaaagatctcatacgtatctcatc
gatcattatttagatccggcaagaattagtgcgcaggggatttttaatgcccaagaaatt
cagaagttgattgcgtcattccgttccggtcactattaccatggtaaacgtttatggtcg
cttgtgattttccagctctggtatgaacagtacatggtagcaaaataa

DBGET integrated database retrieval system