KEGG   Cytophaga hutchinsonii: CHU_3637Help
Entry
CHU_3637          CDS       T00385                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
chu00220  Arginine biosynthesis
chu00330  Arginine and proline metabolism
chu01100  Metabolic pathways
chu01110  Biosynthesis of secondary metabolites
chu01130  Biosynthesis of antibiotics
chu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CHU_3637 (rocF)
   00330 Arginine and proline metabolism
    CHU_3637 (rocF)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CHU_3637 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABG60870
UniProt: Q11NZ4
Position
complement(4191458..4192402)
Genome map
AA seq 314 aa AA seqDB search
MKKPDILVSVPSDIGAQRMGTSLAVDALLVADAERAQPVLKQFSKKTLSSFPEKRGETGP
YVQGKYAKLLSELNNNTAKEISAIVKKQYPLVISGDHSNAIGIMAGIREAIGADKKLGVI
WVDAHADLHTPYTTPSGNLHGMSLSASMGYDNIELSRSTIDAGLKPFWEELKHCGASRLT
PKIGPEDIFFIGLRDFEIQEYHLIRDYKLNHYSPYDVKAKGLTYILDQAVTYFADYDAVY
VSFDVDVLDTSVSTGTGTPVYNGLLLPEAKQVVDTLKRLKNIRLWEFTEINPLLDNNNSM
SKAVIELIDVLMED
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccggacatacttgtttctgttccttctgatattggcgcgcagcgcatgggc
acttcacttgccgtggatgcgctgttggtagcagatgcagaaagagctcaaccagtatta
aaacaattttctaaaaaaacactttcaagttttcctgaaaaaagaggcgaaacaggcccg
tatgtacagggaaaatatgcaaaactcttgtctgaattaaataacaatacagcgaaagaa
atttctgcgatcgtaaaaaaacaatatccgttggttatcagtggtgaccatagtaacgct
attggtattatggccggtatccgtgaagcaatcggtgcagataaaaagttaggcgtgatt
tgggtagacgcacatgccgatctgcatacaccttatactaccccttccggtaatttacac
ggcatgtcgctatcagcatctatggggtatgataatattgaactttccagaagtacgatt
gatgcgggcttgaaacctttctgggaagaattgaaacattgcggagcaagccgccttaca
ccaaagattggtccggaagatattttctttattggtctgcgcgatttcgaaattcaggaa
tatcatttgatccgtgattataaattaaatcattacagcccgtatgatgtaaaagcaaaa
ggtttaacctatatcctggatcaggcagtaacctattttgcggattacgatgcggtgtat
gtttctttcgatgttgatgtgcttgacacaagtgtttctaccggtacgggtacacctgtg
tataacgggctgctcttgcctgaagcgaagcaggttgtcgataccttaaaacgtttgaag
aatatccgtttatgggaatttaccgaaataaatccattgcttgataacaacaacagcatg
agcaaagcggtgattgagctgattgatgtgctgatggaagactag

DBGET integrated database retrieval system