KEGG   Cytophaga hutchinsonii: CHU_3637Help
Entry
CHU_3637          CDS       T00385                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHU_3637 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CHU_3637 (rocF)
Enzymes [BR:chu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CHU_3637 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4191458..4192402)
Genome map
AA seq 314 aa AA seqDB search
MKKPDILVSVPSDIGAQRMGTSLAVDALLVADAERAQPVLKQFSKKTLSSFPEKRGETGP
YVQGKYAKLLSELNNNTAKEISAIVKKQYPLVISGDHSNAIGIMAGIREAIGADKKLGVI
WVDAHADLHTPYTTPSGNLHGMSLSASMGYDNIELSRSTIDAGLKPFWEELKHCGASRLT
PKIGPEDIFFIGLRDFEIQEYHLIRDYKLNHYSPYDVKAKGLTYILDQAVTYFADYDAVY
VSFDVDVLDTSVSTGTGTPVYNGLLLPEAKQVVDTLKRLKNIRLWEFTEINPLLDNNNSM
SKAVIELIDVLMED
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccggacatacttgtttctgttccttctgatattggcgcgcagcgcatgggc
acttcacttgccgtggatgcgctgttggtagcagatgcagaaagagctcaaccagtatta
aaacaattttctaaaaaaacactttcaagttttcctgaaaaaagaggcgaaacaggcccg
tatgtacagggaaaatatgcaaaactcttgtctgaattaaataacaatacagcgaaagaa
atttctgcgatcgtaaaaaaacaatatccgttggttatcagtggtgaccatagtaacgct
attggtattatggccggtatccgtgaagcaatcggtgcagataaaaagttaggcgtgatt
tgggtagacgcacatgccgatctgcatacaccttatactaccccttccggtaatttacac
ggcatgtcgctatcagcatctatggggtatgataatattgaactttccagaagtacgatt
gatgcgggcttgaaacctttctgggaagaattgaaacattgcggagcaagccgccttaca
ccaaagattggtccggaagatattttctttattggtctgcgcgatttcgaaattcaggaa
tatcatttgatccgtgattataaattaaatcattacagcccgtatgatgtaaaagcaaaa
ggtttaacctatatcctggatcaggcagtaacctattttgcggattacgatgcggtgtat
gtttctttcgatgttgatgtgcttgacacaagtgtttctaccggtacgggtacacctgtg
tataacgggctgctcttgcctgaagcgaagcaggttgtcgataccttaaaacgtttgaag
aatatccgtttatgggaatttaccgaaataaatccattgcttgataacaacaacagcatg
agcaaagcggtgattgagctgattgatgtgctgatggaagactag

  All links  
No link information was found.   
DBGET integrated database retrieval system