KEGG   Cytophaga hutchinsonii: CHU_3739Help
Entry
CHU_3739          CDS       T00385                                 

Gene name
yifB
Definition
magnesium chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4320222..4321754)
Genome map
AA seq 510 aa AA seqDB search
MKYDMKKIRTLGQLKAAGYKSKSVKEEMRDNLIDALKKKHNPFTGIKGFEDSVIPQLQTA
ILAKHNIILLGLRGQAKTRIARMMTHLLDEYMPVVAFSELNDDPLKPLSRFAKDAIDEDG
DSTPIQWVHRSERYTEKLATPDVSVSDLIGDVDPIKAASLKLTYADERVIHYGLIPRSHR
GIFVINELPDLQARIQVALFNMLQEGDIQIRGFKLRLPLDIQFVFTANPEDYTNRGSIVT
PLKDRIDSQILTHYPKTIEISKEITAQEANISAHQRKHVNIDDLLSILIEEIAFQARQSE
FVDQKSGVSARMTISAMENLFSYAERRMLINGEKHTCARLSDLYAVIPSITGKVELVYEG
ELEGIANVAYFLIGKAIRSEFTHLFPNPEKLKKDKKKENIYAPIISWFGEGNKIDILNEM
TQEAYEKTLLSIPGLKGLVEKHVPAASAEQQLLLMEFVLNGLAEFSQLSKNKLDQEMQFK
DLVGSMFDVNKPSEDDDEDEQGDDFGFSNN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgacatgaaaaaaatccgcacactgggccagttaaaggcggcgggttataaa
tcaaaaagtgtaaaagaagagatgcgtgataatttgatcgacgcattaaaaaagaaacac
aatccgtttacaggtataaaaggttttgaagactctgttattcctcagctgcaaactgct
attcttgcaaagcataatattattttacttggtttgcgcggacaggcaaagacgcgtatt
gcacgaatgatgacgcatctgctggatgaatacatgccggtggttgctttttcagaattg
aatgacgatccgttgaaaccattgtcgcgtttcgcaaaagatgcaatcgatgaagatggc
gacagcactcctattcaatgggtacacagaagtgagcgttatacagagaaattggcgacg
ccggatgtttcggtttcggatctgatcggtgatgtagacccgatcaaagcagcttcttta
aaattaacctatgccgatgaacgtgtgattcactatggcttgattccacgttcgcacaga
ggaatttttgtaatcaacgaattgcccgatctgcaagcgcgtatacaagtggcattgttc
aacatgctgcaggaaggtgacatccagattcgtggttttaaattacggttgccgcttgat
atacaatttgtatttaccgccaatccggaagactatacaaaccgcggttctattgtaacg
ccattgaaggaccggattgattctcagatattgacgcactatcctaaaaccattgagatc
tctaaagagatcacggcccaggaagcaaacatcagcgcgcatcagcgcaagcatgtaaac
attgacgatctgttaagtatccttattgaagagattgcttttcaggcgcgccagagtgaa
tttgtggatcagaaaagcggtgtgtctgcgcgtatgacaatttcggcgatggagaattta
ttcagttatgccgaacgccgcatgctcattaacggagagaaacatacatgcgcacgtctt
tcagatctgtatgctgtaataccatctattacaggcaaagttgaattggtgtacgaaggg
gaactggaaggtattgctaatgttgcgtatttcctgatcggcaaagccattcgttcagaa
ttcacgcatctttttcctaaccctgaaaagctgaagaaggataagaaaaaagaaaatatt
tatgcacccatcatctcctggtttggtgaaggaaataaaatagatatcctaaacgaaatg
acgcaggaggcgtatgagaaaaccctgctgtcaataccgggcttgaaagggttggttgag
aaacatgttcctgccgcttctgcggaacagcaattgttattgatggaattcgtgttgaac
ggactggcggagttttctcagttaagcaaaaacaaactggaccaggaaatgcagtttaag
gatttagtcggctctatgtttgatgtgaacaaaccaagtgaagatgacgacgaggatgag
caaggtgatgattttggattcagcaataattaa

DBGET integrated database retrieval system