KEGG   Cytophaga hutchinsonii: CHU_3739Help
Entry
CHU_3739          CDS       T00385                                 

Gene name
yifB
Definition
magnesium chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
chu  Cytophaga hutchinsonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHU_3739 (yifB)
Enzymes [BR:chu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CHU_3739 (yifB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4320222..4321754)
Genome map
AA seq 510 aa AA seqDB search
MKYDMKKIRTLGQLKAAGYKSKSVKEEMRDNLIDALKKKHNPFTGIKGFEDSVIPQLQTA
ILAKHNIILLGLRGQAKTRIARMMTHLLDEYMPVVAFSELNDDPLKPLSRFAKDAIDEDG
DSTPIQWVHRSERYTEKLATPDVSVSDLIGDVDPIKAASLKLTYADERVIHYGLIPRSHR
GIFVINELPDLQARIQVALFNMLQEGDIQIRGFKLRLPLDIQFVFTANPEDYTNRGSIVT
PLKDRIDSQILTHYPKTIEISKEITAQEANISAHQRKHVNIDDLLSILIEEIAFQARQSE
FVDQKSGVSARMTISAMENLFSYAERRMLINGEKHTCARLSDLYAVIPSITGKVELVYEG
ELEGIANVAYFLIGKAIRSEFTHLFPNPEKLKKDKKKENIYAPIISWFGEGNKIDILNEM
TQEAYEKTLLSIPGLKGLVEKHVPAASAEQQLLLMEFVLNGLAEFSQLSKNKLDQEMQFK
DLVGSMFDVNKPSEDDDEDEQGDDFGFSNN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgacatgaaaaaaatccgcacactgggccagttaaaggcggcgggttataaa
tcaaaaagtgtaaaagaagagatgcgtgataatttgatcgacgcattaaaaaagaaacac
aatccgtttacaggtataaaaggttttgaagactctgttattcctcagctgcaaactgct
attcttgcaaagcataatattattttacttggtttgcgcggacaggcaaagacgcgtatt
gcacgaatgatgacgcatctgctggatgaatacatgccggtggttgctttttcagaattg
aatgacgatccgttgaaaccattgtcgcgtttcgcaaaagatgcaatcgatgaagatggc
gacagcactcctattcaatgggtacacagaagtgagcgttatacagagaaattggcgacg
ccggatgtttcggtttcggatctgatcggtgatgtagacccgatcaaagcagcttcttta
aaattaacctatgccgatgaacgtgtgattcactatggcttgattccacgttcgcacaga
ggaatttttgtaatcaacgaattgcccgatctgcaagcgcgtatacaagtggcattgttc
aacatgctgcaggaaggtgacatccagattcgtggttttaaattacggttgccgcttgat
atacaatttgtatttaccgccaatccggaagactatacaaaccgcggttctattgtaacg
ccattgaaggaccggattgattctcagatattgacgcactatcctaaaaccattgagatc
tctaaagagatcacggcccaggaagcaaacatcagcgcgcatcagcgcaagcatgtaaac
attgacgatctgttaagtatccttattgaagagattgcttttcaggcgcgccagagtgaa
tttgtggatcagaaaagcggtgtgtctgcgcgtatgacaatttcggcgatggagaattta
ttcagttatgccgaacgccgcatgctcattaacggagagaaacatacatgcgcacgtctt
tcagatctgtatgctgtaataccatctattacaggcaaagttgaattggtgtacgaaggg
gaactggaaggtattgctaatgttgcgtatttcctgatcggcaaagccattcgttcagaa
ttcacgcatctttttcctaaccctgaaaagctgaagaaggataagaaaaaagaaaatatt
tatgcacccatcatctcctggtttggtgaaggaaataaaatagatatcctaaacgaaatg
acgcaggaggcgtatgagaaaaccctgctgtcaataccgggcttgaaagggttggttgag
aaacatgttcctgccgcttctgcggaacagcaattgttattgatggaattcgtgttgaac
ggactggcggagttttctcagttaagcaaaaacaaactggaccaggaaatgcagtttaag
gatttagtcggctctatgtttgatgtgaacaaaccaagtgaagatgacgacgaggatgag
caaggtgatgattttggattcagcaataattaa

DBGET integrated database retrieval system