KEGG   Capra hircus (goat): 100860750Help
Entry
100860750         CDS       T02910                                 

Gene name
LPL
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
chx  Capra hircus (goat)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100860750 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100860750 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100860750 (LPL)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100860750 (LPL)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100860750 (LPL)
  Exosomal proteins of breast milk
   100860750 (LPL)
Heparan sulfate/heparin binding proteins [BR:chx00536]
 Enzymes (General comment) Variety
  100860750 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 478 aa AA seqDB search
MESKALLLLALSVWLQSLTVSHGGLVAADRITGGKDFRDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGQDVAKFMNWMADEFNYPLGNVHLLGYSLGAHAAGIAGSLTSKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEVDIGELLMLKLKWISDSYFSW
SNWWSSPGFDIGKIRVKAGETQKKVIFCSREKMSYLQKGKSPVIFVKCHDKSLNRKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaggccctgcttctgctggctctgagcgtgtggctgcagagtctgaccgtc
tcccacggagggctggtcgccgccgacaggattacaggaggaaaagattttagagacatt
gaaagtaaatttgctctcaggactcccgaagacacagctgaggacacttgccacctcatt
cctggagtgacggaatctgtggctaactgtcacttcaaccacagcagcaagacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaacttgtggct
gccttatacaagagggaaccagactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggacaggatgtggccaag
tttatgaactggatggcggatgaatttaactatcccctgggcaatgtgcatctcttggga
tacagccttggggcccatgctgctggtattgcaggaagtctgaccagtaagaaggtcaac
aggattaccggcctagatccagctggacctaacttcgagtatgcagaagctccaagtcgc
ctttctcctgatgacgcggattttgtagacgttttacacacattcaccagggggtcacct
ggccgaagtatcggaatccagaaaccagtagggcatgttgacatttaccctaacggaggc
actttccaaccaggatgtaacattggggaagctctccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgctcccacgagcgttccgttcatctcttcattgac
tctctgttgaatgaagaaaatccaagtaaggcgtaccggtgcaattccaaagaagccttt
gagaaaggtctctgcctgagctgcagaaagaaccgttgcaacaacatgggctacgagatc
aacaaggtcagagccaaaagaagcagcaagatgtacctgaagactcgttctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctggaactgagagtaatacatac
accaaccaggccttcgagatctctctgtatggcaccgtggctgagagcgagaacatccct
tttaccctgcctgaagtttccacaaataagacatactcctttctactttacacggaggtg
gatattggagaattgctaatgttgaaactcaaatggattagcgattcctacttcagctgg
tccaactggtggagcagccccggctttgatattgggaagatcagagtaaaggcaggagag
actcaaaaaaaggtgatcttctgttcccgggagaaaatgtcttatctgcagaaaggaaag
tcacctgtgatatttgtgaaatgccatgacaagtctctgaatagaaagtctggctga

DBGET integrated database retrieval system