KEGG   Capra hircus (goat): 100860750Help
Entry
100860750         CDS       T02910                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
chx  Capra hircus (goat)
Pathway
chx00561  Glycerolipid metabolism
chx01100  Metabolic pathways
chx03320  PPAR signaling pathway
chx04979  Cholesterol metabolism
chx05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100860750 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100860750 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    100860750 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100860750 (LPL)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100860750 (LPL)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100860750 (LPL)
  Exosomal proteins of breast milk
   100860750 (LPL)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100860750 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
 Enzymes
  100860750 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 100860750
NCBI-ProteinID: NP_001272536
UniProt: A2SY11
Position
8
AA seq 478 aa AA seqDB search
MESKALLLLALSVWLQSLTVSHGGLVAADRITGGKDFRDIESKFALRTPEDTAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGQDVAKFMNWMADEFNYPLGNVHLLGYSLGAHAAGIAGSLTSKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESNTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEVDIGELLMLKLKWISDSYFSW
SNWWSSPGFDIGKIRVKAGETQKKVIFCSREKMSYLQKGKSPVIFVKCHDKSLNRKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaggccctgcttctgctggctctgagcgtgtggctgcagagtctgaccgtc
tcccacggagggctggtcgccgccgacaggattacaggaggaaaagattttagagacatt
gaaagtaaatttgctctcaggactcccgaagacacagctgaggacacttgccacctcatt
cctggagtgacggaatctgtggctaactgtcacttcaaccacagcagcaagacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaacttgtggct
gccttatacaagagggaaccagactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattatccagtgtctgcagggtacaccaagctggtgggacaggatgtggccaag
tttatgaactggatggcggatgaatttaactatcccctgggcaatgtgcatctcttggga
tacagccttggggcccatgctgctggtattgcaggaagtctgaccagtaagaaggtcaac
aggattaccggcctagatccagctggacctaacttcgagtatgcagaagctccaagtcgc
ctttctcctgatgacgcggattttgtagacgttttacacacattcaccagggggtcacct
ggccgaagtatcggaatccagaaaccagtagggcatgttgacatttaccctaacggaggc
actttccaaccaggatgtaacattggggaagctctccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgctcccacgagcgttccgttcatctcttcattgac
tctctgttgaatgaagaaaatccaagtaaggcgtaccggtgcaattccaaagaagccttt
gagaaaggtctctgcctgagctgcagaaagaaccgttgcaacaacatgggctacgagatc
aacaaggtcagagccaaaagaagcagcaagatgtacctgaagactcgttctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctggaactgagagtaatacatac
accaaccaggccttcgagatctctctgtatggcaccgtggctgagagcgagaacatccct
tttaccctgcctgaagtttccacaaataagacatactcctttctactttacacggaggtg
gatattggagaattgctaatgttgaaactcaaatggattagcgattcctacttcagctgg
tccaactggtggagcagccccggctttgatattgggaagatcagagtaaaggcaggagag
actcaaaaaaaggtgatcttctgttcccgggagaaaatgtcttatctgcagaaaggaaag
tcacctgtgatatttgtgaaatgccatgacaagtctctgaatagaaagtctggctga

DBGET integrated database retrieval system