KEGG   Capra hircus (goat): 100860864Help
Entry
100860864         CDS       T02910                                 

Gene name
S-LZ, LYZ, lysozyme
Definition
serum lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
chx  Capra hircus (goat)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100860864 (S-LZ)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100860864 (S-LZ)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100860864 (S-LZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 148 aa AA seqDB search
MKALIILGLLLLSVAVQGKVFERCELARTLKRFGMDGFRGISLANWMCLARWESSYNTQA
TNYNSGDRSTDYGIFQINSHWWCNDGKTPGAVNACHIPCSALLQDDITQAVACAKRVVSD
PQGIRAWVAWRSHCQNQDLTSYIQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattattctggggcttctcctcctttcggtcgctgtccaaggcaaggtc
tttgagagatgtgagcttgccagaactctgaaaagatttggaatggatggctttagggga
atcagcctggcaaactggatgtgtttggccagatgggaaagcagttataacacacaagct
acaaactacaatagtggagacagaagcactgattatgggatatttcaaatcaatagccac
tggtggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcacataccctgcagc
gctttgctgcaagatgacatcactcaagctgtagcatgtgcaaagagggttgtcagtgat
ccacaaggcattagagcatgggtggcatggagaagtcattgtcaaaaccaagatctcacc
agttacattcagggttgtggagtgtaa

DBGET integrated database retrieval system