KEGG   Capra hircus (goat): 100861058Help
Entry
100861058         CDS       T02910                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
chx  Capra hircus (goat)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100861058 (ABAT)
   00650 Butanoate metabolism
    100861058 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100861058 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    100861058 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100861058 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100861058 (ABAT)
Enzymes [BR:chx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100861058 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100861058 (ABAT)
Amino acid related enzymes [BR:chx01007]
 Aminotransferase (transaminase)
  Class III
   100861058 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 483 aa AA seqDB search
MASMLLTQRLVCSFQHNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALMKLVQQPQ
NMSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSSFSKEELETCMVNQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEELRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLNNAAHAGKVLLTGLL
DLQARFPQLISRVRGRGTFCSFDTPDESVRNKLISIARNKGLMLGGCGDKSIRFRPRPQP
LSN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagcggctggtctgcagcttccagcacaactaccgcctg
ttggtgccgggttccagacacatcagtcaggctgcagccaaagtcgacgttgaatttgac
tatgatggacctttgatgaagacggaagtcccagggcctagatctcgggagctaatgaaa
cagttgaatataattcagaatgcagaggctgtacactttttctgcaattatgaagaaagt
cgaggcaattacctggtggatgtggatggcaaccggatgttggatctttattcccagatc
tcctctgtccctataggttacaaccatcctgctctcatgaaacttgtccaacagcctcaa
aatatgagcacattcatcaacagacctgccctcggaatccttcctccggagaactttgtg
gagaagctccgggagtccctgctctcggtggctcccaaagggatgtcccagctcatcacg
atggcctgcggctcctgctccaatgagaatgccttcaagaccatcttcatgtggtacagg
agcaaggaaaggggccagtcgagtttctccaaagaggagctggagacgtgcatggtcaac
caggcccctgggtgccctgactacagcatcctctccttcatgggtgctttccacgggagg
accatgggttgcttagcaaccacacactccaaagccattcacaagatcgacatcccctcc
ttcgactggcccatcgcaccgttcccacggctgaaatatcctttggaagagtttgtgaaa
gagaaccaacaagaggaggcccgctgtctagaagaggtggaggacctgatcgtgaaatac
cggaagaagaagaggacggtggccggcatcattgtggaacccatccagtctgagggtgga
gacaaccacgcgtcggatgacttcttccggaagctgagagacatctccaggaagcacggc
tgtgccttcttggtggacgaggtccagactggaggaggctgtaccggcaagttctgggcc
cacgagcactggggcttggatgacccggcggacgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttgcggcccaacgctccttaccggatcttcaac
acgtggctgggagacccatccaagaacctgctgctggccgaggtcatcaacgtcatcaag
cgagaggacctgctaaacaacgcagcccatgctgggaaggtcctgctcacgggactgctc
gacctccaggcccggttcccccagctcatcagcagagtcagagggcgaggcaccttctgc
tccttcgacactccagatgaatccgtgcggaataaactcatttcaatagccagaaacaaa
ggcctcatgctggggggctgcggcgacaagtccatccgcttccgtcccagacctcaaccg
ttgtccaattga

DBGET integrated database retrieval system