KEGG   Capra hircus (goat): 100861366Help
Entry
100861366         CDS       T02910                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100861366 (KAT5)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100861366 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
29
AA seq 517 aa AA seqDB search
MGKLERNQESPEGGASWPGQSKALAFAVPTALAEILSVKDISGRKLFYVHYIDFNKRLDE
WVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRF
NLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSA
RRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIE
LGRHRLKPWYFSPYPQELTALPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRK
GTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFS
KEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRS
YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTL
SEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctggaaagaaatcaggaaagcccggagggtggagcttcatggcctggccag
tctaaggcccttgcctttgctgttcccacagcactcgctgagattctgagcgtgaaggac
atcagtggccggaagcttttctacgtccattacattgatttcaacaaacgcctggatgaa
tgggtgacccacgagcggctggacctgaagaagatccagttccccaagaaagaggccaag
acccccactaagaacggacttcctgggtcccgacccggctctccagagagagaggtgccg
gcctccgcccaggccagcgggaagactttgccaatcccggttcagatcacactccgcttc
aacctgcccaaggagcgggaggccattcccggtggcgagcccgaccagccgctctcctcc
agctcctgcctgcagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcacca
gcaactccagtgcccagtgagacagccccggcctcagttttcccccagaatggatcagcc
cggagggcagtggcagctcagcccgggcggaagcggaaatcgaattgtttgggcactgat
gaggactcccaggacagctcagatggaatcccgtccgctcctcgcatgactgggagcctg
gtatctgaccggagccacgacgacatcgtcacccggatgaagaacatcgagtgtatcgag
ctgggccggcaccgcctcaagccctggtacttctccccgtaccctcaggagctcaccgcg
ctgcccgtcctctacctctgcgagttctgcctcaagtatggccgaagcctcaagtgtctg
cagcgtcacttgaccaagtgtgacctgcgacatcctcccggcaatgagatctaccgcaag
ggcaccatctccttctttgagatcgacggacgtaagaacaagagttactcccaaaacctg
tgtcttctggctaagtgtttcctcgaccacaagacgctgtactatgacacagaccctttc
ctcttctacgtcatgacagagtacgactgcaagggcttccatatagtgggctacttctcc
aaggaaaaggagtccacggaagactacaacgtggcctgcatcctgaccctgcccccctac
cagcgccggggctacggaaagctgctgatcgagttcagctatgaactctccaaagtggaa
gggaaaacggggacccctgagaagcccctctcggaccttggcctcctgtcctaccgaagc
tactggtcccagaccatcctggagatcttgatggggttgaagtcagagagcggggagagg
ccacagatcaccatcaatgagatcagtgaaattaccagcatcaagaaggaggatgtcata
tccactctacagtacctcaacctcatcaactactacaagggccagtatatcctcaccctg
tcggaggacatcgtggatgggcacgaacgggctatgctcaaacggcttcttcggatcgac
tccaagtgtctgcacttcactcccaaggactggagcaagaggggaaagtggtga

DBGET integrated database retrieval system