KEGG   Capra hircus (goat): 102168229Help
Entry
102168229         CDS       T02910                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
chx  Capra hircus (goat)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102168229 (EEF2K)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    102168229 (EEF2K)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102168229 (EEF2K)
Protein kinases [BR:chx01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   102168229 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 722 aa AA seqDB search
MAEEDLIFRLEGVDGGPASRAGDSDTDSDDDEEGYFICSITDDPGAHQNVNFKVNCHSNL
AKSERYGSSGSPAGSFHFKEAWKHAIEKAKHMPDPWAEFHLEDVATECATRHRYNAVTGE
WVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRDVYFE
DVRLQMEAKLWGEEYNRHKPPKQVDIMQMCVIELKERPGRPLFHLEHYIEGKYIKYNSNS
GFVRDDNVRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTERGTDFGDGNLGVR
GMALFFHSHACNRICKSMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSPRVR
TLSGSRPPLLLRLSENSGDDNMSDVTFDSLPSSPSSATPQSQKLDHLHWPVFSDLDNMAP
RDQDPLDNHRDSENSGDSGYPSEKRGDLDDPEPREHGHSNGNRRYESDEDSLGSSGRVCV
EKWNLFNSSRLHLPRPSAVALEVQRLNALDLEKKIGKSILGKGHLAMVRYHEAGRFCEKD
EEWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEANKTKGFDYLLK
AAEAGDRQCMILVARAFDTGQNLSPDRSQSWPEALHWYNTALETTDCDEGGEYDGMQDEP
RYMLLAREAEMLFTGGCGLEKDPQRSGDLYTQAAEAAIEAMKGRLANQYYEKAEEAWAQM
EE
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaagacctcatcttccgcctggaaggcgtggatggcggcccagcctcccgg
gctggtgattcagacacagacagcgacgatgatgaggagggttacttcatctgctccatc
accgatgaccccggggcacaccagaatgtcaacttcaaggttaactgccacagcaaccta
gcaaagagcgagcgctacggctccagtgggtccccggccggctccttccatttcaaggaa
gcttggaagcatgcaatcgagaaagccaagcacatgcctgacccctgggctgagttccac
ctggaagacgttgccacagaatgcgccacgcgccacaggtacaacgctgtcaccggcgag
tgggtggaagatgaagtcctaatcaagatggcgtctcagcccttcggccggggagcaatg
agggagtgcttcaggacgaagaagctctccaacttcctgcacacccagcagtggaagggg
gcctccaactacgtggcaaagcgctacatcgagtccgtggacagggatgtgtacttcgag
gacgtgcgtctacagatggaggccaagctctggggagaggagtataatcggcacaagccc
cccaagcaggtggacatcatgcagatgtgcgtcatagagctgaaggagagaccgggccgg
ccgctgttccacctggaacactacatcgagggcaagtacatcaagtacaactccaactca
ggcttcgtccgtgatgacaacgtgcgcctaacgccgcaggccttcagccacttcacgttt
gagcgttccggccaccagctgattgtggtggacatccagggtgtgggtgatctctacact
gacccgcagatccacactgagaggggcactgactttggagatggaaatctaggtgtccgt
gggatggccctcttcttccactcgcatgcctgcaaccggatttgcaagagcatgggcctc
gctccctttgacctgtccccaagagagagggatgcagtgaatcagaacaccaagctgctg
cagtcagccaagaccatcttaaggggtacagaggaaaagtgcgggagcccgcgggtgagg
accctctcagggagccggcccccactgctccttcgcctctcagagaactctggagatgac
aacatgagtgacgtgacctttgactctctcccttcctcgccgtcttcagccacgccacag
agccagaaactggaccacctccattggcctgtgttcagcgacctcgataacatggcacct
cgagaccaggaccctctggacaaccaccgggactctgagaacagtggggacagtggatac
cccagtgagaagcggggtgacctggatgacccagagcccagagaacatggccactcaaac
ggtaaccggaggtacgagtcggatgaagacagcctgggcagctccggacgggtctgtgtg
gagaagtggaatctcttcaactcctcccgcctccacctgccgagaccttcagctgtggcc
ctggaagtgcagaggctcaacgctctggacctcgagaagaaaatcgggaagtccattttg
gggaagggccatctggccatggtgcgctaccacgaggccggccgcttctgtgagaaggac
gaggagtgggaccaggagtcggcagtcttccacctggagcatgcagccgacctgggcgag
ctggaggccatcgtgggcctgggactcatgtactcgcagctgccccaccacatcctggca
gatgtctctctgaaggagacagaagcgaacaaaaccaaaggatttgattacttactgaag
gcagccgaagctggtgacaggcagtgcatgattctggtggcgcgagcctttgacactggc
cagaacctcagccctgacaggtcccagagctggccagaggctctccactggtacaacact
gccctggagacaactgactgtgatgagggtggggagtatgatgggatgcaagacgaaccc
cggtacatgctgctggccagggaggcggagatgctgttcacaggcggctgcgggctggaa
aaggacccacagagatcaggtgacttgtacacccaggcagccgaggcagcgatagaagcc
atgaagggccggctggccaaccagtactacgagaaagcagaggaggcctgggcccagatg
gaggaataa

DBGET integrated database retrieval system