KEGG   Capra hircus (goat): 102168499Help
Entry
102168499         CDS       T02910                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
chx  Capra hircus (goat)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102168499 (PPOX)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102168499 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYYLSRAPCPPKVVLVEGSERLGGWIRSVRGPDGAIFELGPRG
IRPAGALGARTLLLISELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPSGIRGLLRPSP
PFSKPLFWAGLRDLTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRGPQLDSALIRQARAERWSQWSLRGGLETLPQAL
NAHLTSRGVSVLQGQPVCGLSLQAEGRWKVSLEDSSLEADHIISAIPASVLSKLLPAEAA
PLARALSTITAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPVILGIVYDSVAFPEQDGSL
PGLRLTVMLGGSWLQTLEARGCVLSQELLQQEAEKAAATQLGLNEPPSHCLVHLHKNSIP
QYTLGHWQKLESAAQFLAAQKLPLTLAGASYEGVAVNDCIESGRQAAARVLGTEPNS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggacggtggtcgtgctgggcggagggatcagcggcttggccgccagttactac
ctgagtcgggccccctgtccccccaaggtggtcttggtggagggcagcgagcgcctggga
ggctggatccgctcagtacgcgggccagatggtgctatttttgaacttggacctcgagga
attcggccggcaggagccctgggagcccggaccctgctcctgatttctgagcttggcttg
gactcagaagtgttgcctgtccggggagaccatccagctgcccagaacaggttcctgtat
gtaggtggtgctctgcatgccttgccctctggcatcagggggctcctccgcccttcacct
cccttctccaagcctctgttctgggctgggctgagggatttgaccacccctcgtggcaaa
gaccctgatgagactgtgcacagttttgcccagcgccgccttggtcctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccaccgttccatattactgggg
ctgctgctgggggcaggccggggcccacagctggactcagcacttattcgccaagctcgg
gctgagcgctggagccagtggtcactccgtggagggctggagacattgccccaggccctc
aacgcccacctgactagtaggggtgtcagtgttctccaaggccagccagtctgtgggctc
agtctccaggcagaagggcgctggaaggtgtctctagaggacagcagcctggaggctgac
cacattattagtgccattccagcttcagtgctcagcaagctgctccctgctgaggctgca
cctctggcccgtgccctgagcaccatcactgctgtgtctgtggctgtggtgaatctgcag
taccgaggagctcgtctgcctgtccagggatttggacatttggtgccttcctcagaagat
ccagttatcctgggaattgtgtatgactccgttgctttccctgagcaggatgggagcctg
cctggcctcagactgactgtgatgctgggaggttcctggttacagacactagaagccagg
ggctgtgtcttatctcaggagctgctccaacaggaggcagagaaagctgctgccactcaa
ttaggactgaatgagccaccaagtcactgcttggtccatctacacaagaactctatcccc
cagtatacattaggccactggcaaaaattggagtcagctgcccaattcctggctgctcag
aagctgcctttgactctggccggggcctcctatgagggggttgctgtcaatgattgtata
gagagtgggcgtcaggcagcagcccgtgtcttaggcacagaacctaacagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system